Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.46
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.4e-03
group 3 medulloblastoma 4104 7.4e-03
lung cancer 4740 2.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.4e-03
lung cancer 1.400 2.6e-02
ovarian cancer 1.600 2.4e-03

Gene RIF (2)

AA Sequence

MLMAWCRGPVLLCLRQGLGTNSFLHGLGQEPFEGARSLCCRSSPRDLRDGEREHEAAQRKAPGAESCPSL      1 - 70
PLSISDIGTGCLSSLENLRLPTLREESSPRELEDSSGDQGRCGPTHQGSEDPSMLSQAQSATEVEERHVS     71 - 140
PSCSTSRERPFQAGELILAETGEGETKFKKLFRLNNFGLLNSNWGAVPFGKIVGKFPGQILRSSFGKQYM    141 - 210
LRRPALEDYVVLMKRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVR    211 - 280
KDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATEDIKSLTFDAVALDMLNPHVTLPVFYPHL    281 - 350
KHGGVCAVYVVNITQVIELLDGIRTCELALSCEKISEVIVRDWLVCLAKQKNGILAQKVESKINTDVQLD    351 - 420
SQEKIGVKGELFQEDDHEESHSDFPYGSFPYVARPVHWQPGHTAFLVKLRKVKPQLN                 421 - 477
//

Text Mined References (13)

PMID Year Title