Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.68
PubTator Score 10.94

Knowledge Summary

Patent (1,069)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 8.9e-06
lung cancer 4740 4.5e-04
osteosarcoma 7950 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 31 3.432 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.900 4.5e-04
osteosarcoma -1.166 2.2e-02
ovarian cancer -1.300 8.9e-06

Gene RIF (5)

AA Sequence

MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAWERTKTV      1 - 70
QGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRD     71 - 140
YHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHHVEDPASVYD    141 - 210
EAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYE    211 - 280
SELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGS    281 - 350
ENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK    351 - 420
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSA    421 - 490
VSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE            491 - 552
//

Text Mined References (25)

PMID Year Title