Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 2
Funding $658,993.21
PubMed Score 13.32
PubTator Score 10.94

Knowledge Summary

Patent (1,069)

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.166 0.022
lung cancer 1.900 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q9BVS4 D6RDI3 Q9NUT0
Symbols RIO2

Gene

PDB

5DHF  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
25891899 As RIO2 is involved in the biosynthesis of the ribosome and cell cycle regulation, our selective ligand may be useful for the delineation of the biological role of this kinase.
23459592 reduced expression of RIOK1 or RIOK2 disrupted Akt signaling and caused cell cycle exit, apoptosis, and chemosensitivity in glioblastoma cells
21880710 Plk1-mediated phosphorylation of Rio2 regulates metaphase-anaphase transition during mitotic progression.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19564402 Results show that the protein kinase human Rio2 (hRio2) is part of a late 40S preribosomal particle in human cells.

AA Sequence

MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAWERTKTV      1 - 70
QGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRD     71 - 140
YHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHHVEDPASVYD    141 - 210
EAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYE    211 - 280
SELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGS    281 - 350
ENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK    351 - 420
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSA    421 - 490
VSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE            491 - 552
//

Text Mined References (24)

PMID Year Title
25891899 2015 Discovery of selective RIO2 kinase small molecule ligand.
23459592 2013 A kinome-wide RNAi screen in Drosophila Glia reveals that the RIO kinases mediate cell proliferation and survival through TORC2-Akt signaling in glioblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21880710 2011 Phosphorylation of right open reading frame 2 (Rio2) protein kinase by polo-like kinase 1 regulates mitotic progression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
More...