Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 8.0e-10
lung cancer 4740 3.0e-04
group 3 medulloblastoma 4104 1.9e-02
ependymoma 4679 2.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 2.9e-02
group 3 medulloblastoma -1.200 1.9e-02
lung cancer -1.200 3.0e-04
malignant mesothelioma -4.500 8.0e-10

Synonym

Accession Q9BVR0
Symbols D15F37S4

Gene

 Compartment GO Term (0)

AA Sequence

MHAFCVGQYLEPDQEGVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFS      1 - 70
GGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIE     71 - 140
RYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRV    141 - 210
VYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPHWRRIAQKIIRE    211 - 280
PRKKRVPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLK    281 - 350
QNVQGLYPQSPLLSTIAEFALKEEPVDVEKRKCLLKQLERAEVRLEGIDTILKLYLVSKNFLLPSVPYAM    351 - 420
FCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLVDASAKFKELGIQPV    421 - 490
PLQTITNENPSGPSLGTIPQAHFLLVMLSMLTLQHSANNLDLLLNSGTLALAQTALRLIGPSCDSVEEDM    491 - 560
NASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDRPPPGLGRVIGELGEDG    561 - 630
WIRVQWDTGSTNSYRMGKEGNYDLKLAELPAPAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQ    631 - 700
TLCLSAGVHAEIMQSEATKTLCGLLQMLVYREQHRSWCTLGFVQSIALTLQVCGTLSSLQWITLLMKVVE    701 - 770
GHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLMEKLFDFLGSLLTMCSSDVPLLRESTLRRRR    771 - 840
VCPQASLTATHSSTLAEEVVALLHTLHSLTQWNGLINKYINSQLRSITHSFAGRPSKGAQLEDYFPDSEN    841 - 910
PEVGGLMAVLAVVGGIDGRLCLGGQVVHDDFGEVTMTRITLKGKITVQFSDMRTCHVCPLNQLKPLPAVA    911 - 980
FNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALFSHQD    981 - 1050
KLRQILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEERM   1051 - 1120
SRCCFWRRRTTKLEQILLFIRRMNSVCEKENTNATASN                                   1121 - 1158
//

Text Mined References (7)

PMID Year Title