Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 8.04467910791687E-10
lung cancer 4473 2.9995274718887E-4
group 3 medulloblastoma 2254 0.0187780006259627
ependymoma 2514 0.0293279616572302


  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -4.500 0.000
ependymoma -1.100 0.029
lung cancer -1.200 0.000
group 3 medulloblastoma -1.200 0.019


Accession Q9BVR0
Symbols D15F37S4


 Compartment GO Term (0)

AA Sequence

SRCCFWRRRTTKLEQILLFIRRMNSVCEKENTNATASN                                   1121 - 1158

Text Mined References (7)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9949213 1999 The ancestral gene for transcribed, low-copy repeats in the Prader-Willi/Angelman region encodes a large protein implicated in protein trafficking, which is deficient in mice with neuromuscular and spermiogenic abnormalities.
9730612 1998 Expressed copies of the MN7 (D15F37) gene family map close to the common deletion breakpoints in the Prader-Willi/Angelman syndromes.
1608955 1992 A putative gene family in 15q11-13 and 16p11.2: possible implications for Prader-Willi and Angelman syndromes.