Property Summary

NCBI Gene PubMed Count 78
Grant Count 17
R01 Count 4
Funding $1,699,040.63
PubMed Score 91.23
PubTator Score 93.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
non diabetic and post-ischemic heart fai... -1.100 0.008
medulloblastoma, large-cell 1.200 0.001
acute quadriplegic myopathy 1.139 0.000
lung cancer 2.200 0.000
colon cancer 1.300 0.000
spina bifida -1.027 0.043
Pick disease -1.300 0.000
progressive supranuclear palsy -1.200 0.006
ovarian cancer 2.500 0.000
dermatomyositis 1.200 0.001

Gene RIF (53)

PMID Text
26722529 The expression level of GNL3 was examined in 89 human gastric cancer samples using immunohistochemistry (IHC) staining. GNL3 in gastric cancer tissues was significantly upregulated compared with paracancerous tissues.
26517370 Study demonstrated overexpression of NS in most hepatocellular carcinoma tissues compared with their matched surrounding tissues, and silencing NS promoted UV- and serum starvation-induced apoptosis of MHCC97H and Bel7402 cells.
26429724 over-expression of GNL3 and SKA3 in the PC-3 human prostate cancer cell line decreased in vitro cell migration and invasion
25699361 Silence of nucleostemin inhibit cell proliferation through up-regulating p21 expression and nucleostemin may be involved in the pathogenesis of esophageal squamous cell carcinoma.
25347121 p53 activation by inauhzin via inhibiting SIRT1, also inhibits cellular IMPDH2 activity, reduces the levels of cellular GTP and GTP-binding nucleostemin, thus representing in a new anti-cancer strategy.
24960197 Gene expression profiling analysis revealed that cell cycle regulators and nucleotide metabolism-related genes were highly enriched in a gene set associated with leukaemia-initiating capacity that we termed the 'leukaemia stem cell gene signature'.
24886551 cis-acting regulatory polymorphisms acting on GNL3 and SPCS1 contribute to the OA association signal at chromosome 3p21, and these genes therefore merit further investigation.
24769896 overexpression of NS suppressed ARF polyubiquitination by its E3 ligase Ubiquitin Ligase for ARF and elongated its half-life, whereas knockdown of NS led to the decrease of ARF levels
24763828 Based on our results, NS overexpression seems to have a causative role in gastric tumorigenesis and/or progression, and it could be considered as a potential tumor marker for diagnosis, molecular classification
24762489 It is concluded that nucleostemin expression could not be specific in a certain type of cells in colon cancer cell line HT29.
More...

AA Sequence

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQR      1 - 70
LEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEA     71 - 140
SDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKP    141 - 210
KDKGKITKRVKAKKNAAPFRSEVCFGKEGLWKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMC    211 - 280
NVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVV    281 - 350
LKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV    351 - 420
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDS    421 - 490
DQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDDAYDFSTDYV               491 - 549
//

Text Mined References (85)

PMID Year Title
26722529 2015 Guanine nucleotide binding protein-like 3 is a potential prognosis indicator of gastric cancer.
26517370 2015 Nucleostemin Knockdown Sensitizes Hepatocellular Carcinoma Cells to Ultraviolet and Serum Starvation-Induced Apoptosis.
26429724 2015 GNL3 and SKA3 are novel prostate cancer metastasis susceptibility genes.
25699361 Knockdown of nucleostemin can inhibit the proliferation of esophageal carcinoma cells in vitro through upregulating p21.
25569094 2015 Telomerase reverse transcriptase regulates microRNAs.
25347121 2014 The role of IMP dehydrogenase 2 in Inauhzin-induced ribosomal stress.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...