Property Summary

NCBI Gene PubMed Count 83
PubMed Score 99.97
PubTator Score 93.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.139 4.4e-05
colon cancer 1.300 4.0e-07
dermatomyositis 1.200 7.0e-04
lung cancer 2.200 1.0e-05
medulloblastoma, large-cell 1.200 7.2e-04
non diabetic and post-ischemic heart fai... -1.100 7.8e-03
ovarian cancer 2.500 1.2e-05
Pick disease -1.300 2.4e-05
progressive supranuclear palsy -1.200 6.4e-03
spina bifida -1.027 4.3e-02

Gene RIF (56)

AA Sequence

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQR      1 - 70
LEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEA     71 - 140
SDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKP    141 - 210
KDKGKITKRVKAKKNAAPFRSEVCFGKEGLWKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMC    211 - 280
NVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVV    281 - 350
LKYTVPGYRNSLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV    351 - 420
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDS    421 - 490
DQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDDAYDFSTDYV               491 - 549
//

Text Mined References (91)

PMID Year Title