Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.38
PubTator Score 6.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.400 2.3e-20
ependymoma -1.100 5.9e-09
group 4 medulloblastoma -1.400 4.0e-07
intraductal papillary-mucinous carcinoma... 1.100 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.2e-04
invasive ductal carcinoma 1.100 3.8e-04
lung cancer 1.200 2.7e-03
malignant mesothelioma 1.100 3.9e-06
medulloblastoma, large-cell -1.500 1.2e-04
psoriasis 1.200 6.2e-04
subependymal giant cell astrocytoma -1.079 2.7e-02

Gene RIF (3)

AA Sequence

MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELQEGPLSTPPPPGDTGGKESRGPCSGTLVDANSNSPAVP      1 - 70
CRCCQEHGPGLENRQDPSQEEEGAASPSDPGCSSSLSSCSDLSPDESPVSVYLRDLPGDEDAHPQPSIIP     71 - 140
LEQGSPLASAGPGTCSPDSFCCSPDSCSGASSSPDPGLDSNCNALTTCQDVPSPGLEEEDERAEQDLPTS    141 - 210
ELLEADDGKIDAGKTEPSWKINPIWKIDTEKTKAEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSGWKTN    211 - 280
TRITDSGSKTDAGKIDGGWRSDVSEEPVPHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDT    281 - 350
ELPPSGSPGGSSAPPREVTTFKELRSRSRAPAPPVPPRDPPVGWALVPPRPPPPPVPPRRKKNRPGLQPI    351 - 420
AEGQSEEGRAVSPAAGEEAPAAKEPGAQAGLEVRSSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGLLIA    421 - 490
VSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPW    491 - 560
SVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPT    561 - 630
GFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGG    631 - 700
RLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQERP    701 - 770
LPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAP    771 - 840
RMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGMEGLVPVGYTSLVL            841 - 902
//

Text Mined References (15)

PMID Year Title