Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.05
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.300 1.1e-03
invasive ductal carcinoma 1.100 2.7e-03
medulloblastoma, large-cell -1.300 8.7e-04
ovarian cancer 2.300 3.1e-05
posterior fossa group B ependymoma 1.400 2.1e-06

Synonym

Accession Q9BVM2 A8K289 Q6QNL3 Q8N5R1 Q9UFY6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD      1 - 70
PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF     71 - 140
SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ           141 - 203
//

Text Mined References (15)

PMID Year Title