Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.70
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.05251965534972E-6
ovarian cancer 8492 3.08165181768032E-5
medulloblastoma, large-cell 6234 8.66769752119753E-4
group 4 medulloblastoma 1875 0.00113922218823104
invasive ductal carcinoma 2950 0.00269645795611082

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.300 0.001
medulloblastoma, large-cell -1.300 0.001
posterior fossa group B ependymoma 1.400 0.000
invasive ductal carcinoma 1.100 0.003
ovarian cancer 2.300 0.000

Synonym

Accession Q9BVM2 A8K289 Q6QNL3 Q8N5R1 Q9UFY6
Symbols

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
14630615 a novel candidate gene for primary ciliary dyskinesia
14630615 The mouse homolog of this gene (named Dpcd, for Deleted in a mouse model of Primary Ciliary Dyskinesia) appears to be responsible for an inner arm defect in cilia.

AA Sequence

MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD      1 - 70
PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF     71 - 140
SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ           141 - 203
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...