Property Summary

NCBI Gene PubMed Count 9
PubMed Score 35.98
PubTator Score 10.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 5.7e-03
Atopic dermatitis 1.500 1.9e-04
atypical teratoid / rhabdoid tumor -1.900 4.5e-04
glioblastoma -1.500 2.3e-03
group 4 medulloblastoma -1.100 4.3e-02
medulloblastoma, large-cell -2.200 2.1e-04
osteosarcoma -1.691 5.3e-07
pancreatic ductal adenocarcinoma liver m... -2.141 7.5e-04
Pick disease -1.400 1.5e-04

Synonym

Accession Q9BVL4 Q2TAL2 Q5JZ81 Q8WUI0 SelO
Symbols SELO

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAVYRAALGASLAAARLLPLGRCSPSPAPRSTLSGAAMEPAPRWLAGLRFDNRALRALPVEAPPPGPEGA      1 - 70
PSAPRPVPGACFTRVQPTPLRQPRLVALSEPALALLGLGAPPAREAEAEAALFFSGNALLPGAEPAAHCY     71 - 140
CGHQFGQFAGQLGDGAAMYLGEVCTATGERWELQLKGAGPTPFSRQADGRKVLRSSIREFLCSEAMFHLG    141 - 210
VPTTRAGACVTSESTVVRDVFYDGNPKYEQCTVVLRVASTFIRFGSFEIFKSADEHTGRAGPSVGRNDIR    211 - 280
VQLLDYVISSFYPEIQAAHASDSVQRNAAFFREVTRRTARMVAEWQCVGFCHGVLNTDNMSILGLTIDYG    281 - 350
PFGFLDRYDPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQ    351 - 420
KMRRKLGLVQVELEEDGALVSKLLETMHLTGADFTNTFYLLSSFPVELESPGLAEFLARLMEQCASLEEL    421 - 490
RLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQ    491 - 560
AYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCE    561 - 630
AGAATDAEATEADGADGRQRSYSSKPPLWAAELCVTUSS                                   631 - 669
//

Text Mined References (10)

PMID Year Title