Property Summary

NCBI Gene PubMed Count 9
PubMed Score 32.59
PubTator Score 10.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Synonym

Accession Q9BVL4 Q2TAL2 Q5JZ81 Q8WUI0 SelO
Symbols SELO

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
S.cerevisiae EggNOG Inparanoid

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
24751718 SelO is a redox-active mitochondrial selenoprotein.
223596 The SELO protein has a protein domain with significant albeit remote sequence similarity to protein kinase-like proteins.

AA Sequence

MAVYRAALGASLAAARLLPLGRCSPSPAPRSTLSGAAMEPAPRWLAGLRFDNRALRALPVEAPPPGPEGA      1 - 70
PSAPRPVPGACFTRVQPTPLRQPRLVALSEPALALLGLGAPPAREAEAEAALFFSGNALLPGAEPAAHCY     71 - 140
CGHQFGQFAGQLGDGAAMYLGEVCTATGERWELQLKGAGPTPFSRQADGRKVLRSSIREFLCSEAMFHLG    141 - 210
VPTTRAGACVTSESTVVRDVFYDGNPKYEQCTVVLRVASTFIRFGSFEIFKSADEHTGRAGPSVGRNDIR    211 - 280
VQLLDYVISSFYPEIQAAHASDSVQRNAAFFREVTRRTARMVAEWQCVGFCHGVLNTDNMSILGLTIDYG    281 - 350
PFGFLDRYDPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQ    351 - 420
KMRRKLGLVQVELEEDGALVSKLLETMHLTGADFTNTFYLLSSFPVELESPGLAEFLARLMEQCASLEEL    421 - 490
RLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQ    491 - 560
AYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCE    561 - 630
AGAATDAEATEADGADGRQRSYSSKPPLWAAELCVTUSS                                   631 - 669
//

Text Mined References (9)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24751718 2014 Characterization of mammalian selenoprotein o: a redox-active mitochondrial protein.
22359664 2012 A novel protein kinase-like domain in a selenoprotein, widespread in the tree of life.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12775843 2003 Characterization of mammalian selenoproteomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
223596 1979 Serum lipid and lipoprotein levels in Japanese patients with familial hypercholesterolemia.