Property Summary

NCBI Gene PubMed Count 9
PubMed Score 32.59
PubTator Score 10.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
24751718 SelO is a redox-active mitochondrial selenoprotein.
223596 The SELO protein has a protein domain with significant albeit remote sequence similarity to protein kinase-like proteins.

AA Sequence

MAVYRAALGASLAAARLLPLGRCSPSPAPRSTLSGAAMEPAPRWLAGLRFDNRALRALPVEAPPPGPEGA      1 - 70
PSAPRPVPGACFTRVQPTPLRQPRLVALSEPALALLGLGAPPAREAEAEAALFFSGNALLPGAEPAAHCY     71 - 140
CGHQFGQFAGQLGDGAAMYLGEVCTATGERWELQLKGAGPTPFSRQADGRKVLRSSIREFLCSEAMFHLG    141 - 210
VPTTRAGACVTSESTVVRDVFYDGNPKYEQCTVVLRVASTFIRFGSFEIFKSADEHTGRAGPSVGRNDIR    211 - 280
VQLLDYVISSFYPEIQAAHASDSVQRNAAFFREVTRRTARMVAEWQCVGFCHGVLNTDNMSILGLTIDYG    281 - 350
PFGFLDRYDPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQ    351 - 420
KMRRKLGLVQVELEEDGALVSKLLETMHLTGADFTNTFYLLSSFPVELESPGLAEFLARLMEQCASLEEL    421 - 490
RLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQLSAAELQSRNQGHWADWLQ    491 - 560
AYRARLDKDLEGAGDAAAWQAEHVRVMHANNPKYVLRNYIAQNAIEAAERGDFSEVRRVLKLLETPYHCE    561 - 630
AGAATDAEATEADGADGRQRSYSSKPPLWAAELCVTUSS                                   631 - 669
//

Text Mined References (9)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24751718 2014 Characterization of mammalian selenoprotein o: a redox-active mitochondrial protein.
22359664 2012 A novel protein kinase-like domain in a selenoprotein, widespread in the tree of life.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12775843 2003 Characterization of mammalian selenoproteomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
223596 1979 Serum lipid and lipoprotein levels in Japanese patients with familial hypercholesterolemia.