Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.39
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.100 3.6e-02
astrocytic glioma -1.500 6.9e-03
Astrocytoma, Pilocytic -1.300 2.5e-04
atypical teratoid / rhabdoid tumor 1.700 2.8e-03
colon cancer 2.300 2.3e-02
glioblastoma 1.400 2.9e-03
group 4 medulloblastoma 1.200 2.1e-03
hepatocellular carcinoma -1.900 8.1e-04
intraductal papillary-mucinous adenoma (... 1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.4e-02
medulloblastoma, large-cell 2.500 1.1e-05
nasopharyngeal carcinoma 1.200 4.3e-04
non-small cell lung cancer -1.712 2.4e-17
oligodendroglioma -1.800 1.2e-02
osteosarcoma -2.158 3.9e-05
ovarian cancer -2.100 1.9e-15
pancreatic ductal adenocarcinoma liver m... 1.311 1.6e-02
Pick disease 1.400 3.5e-04
posterior fossa group B ependymoma -1.500 1.7e-06
primitive neuroectodermal tumor 1.300 1.2e-02
Rheumatoid arthritis 2.200 4.9e-03
spina bifida -2.415 3.1e-02
tuberculosis -1.300 2.7e-04

Protein-protein Interaction (8)

Gene RIF (1)

AA Sequence

MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGS      1 - 70
KPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSAL     71 - 140
TSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATST    141 - 210
AGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAM    211 - 280
LKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILV    281 - 350
QQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY    351 - 420
RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGT    421 - 490
PFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI    491 - 560
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR                                   561 - 599
//

Text Mined References (21)

PMID Year Title