Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.23
PubTator Score 3.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.43137250577813E-17
ovarian cancer 8492 1.87578348862913E-15
tuberculosis and treatment for 3 months 327 5.06327440994329E-7
posterior fossa group B ependymoma 1530 1.70498306519417E-6
medulloblastoma, large-cell 6234 1.13584853435615E-5
osteosarcoma 7933 3.88719123089396E-5
primitive neuroectodermal tumor 3031 1.33711492154643E-4
pilocytic astrocytoma 3086 2.02790538643162E-4
Pick disease 1893 3.53306175992697E-4
nasopharyngeal carcinoma 1056 4.34587815223461E-4
hepatocellular carcinoma 550 8.11900271864172E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00202701416565877
pediatric high grade glioma 2712 0.00277759688490049
atypical teratoid / rhabdoid tumor 4369 0.00279184973694887
glioblastoma 5572 0.00285179575053438
medulloblastoma 1524 0.00406505086137764
Rheumatoid Arthritis 1171 0.00489546963036624
oligodendroglioma 2849 0.0117548158637264
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0156067482098424
astrocytic glioma 2241 0.0173288988443726
colon cancer 1475 0.0229136296489368
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0238113487212954
spina bifida 1064 0.0314488750199793

Expression

Synonym

Accession Q9BVL2 A6NI12 B4DZJ1 O43160 Q5JRG2 Q5JRG5
Symbols NUP45
NUPL1
PRO2463

Gene

PDB

5IJN   5IJO   4JO7   4JO9   4JQ5  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
Fruitfly OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
7531196 The human gene NUPL1 shares 87% sequence identity with rat nucleoporin p58.

AA Sequence

MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGS      1 - 70
KPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSAL     71 - 140
TSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATST    141 - 210
AGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAM    211 - 280
LKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILV    281 - 350
QQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY    351 - 420
RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGT    421 - 490
PFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI    491 - 560
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR                                   561 - 599
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
More...