Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
Funding $136,607.3
PubMed Score 5.23
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BVL2 A6NI12 B4DZJ1 O43160 Q5JRG2 Q5JRG5
Symbols NUP45
NUPL1
PRO2463

Gene

PDB

5IJN   5IJO   4JO7   4JO9   4JQ5  

Gene RIF (1)

PMID Text
7531196 The human gene NUPL1 shares 87% sequence identity with rat nucleoporin p58.

AA Sequence

MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGS      1 - 70
KPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSAL     71 - 140
TSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATST    141 - 210
AGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAM    211 - 280
LKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILV    281 - 350
QQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGY    351 - 420
RKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGT    421 - 490
PFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI    491 - 560
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR                                   561 - 599
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
More...