Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $424,326.83
PubMed Score 1.45
PubTator Score 0.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.444 0.001
glioblastoma 1.100 0.003
lung cancer 1.200 0.002
ovarian cancer 1.600 0.000

Synonym

Accession Q9BVK8 A8MWW0 O75790
Symbols NIFIE14

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (1)

PMID Text
20538592 TMEM147 is a novel core component of the Nicalin-NOMO complex, further emphasizing its similarity with gamma-secretase.

AA Sequence

MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGE      1 - 70
FMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSN     71 - 140
ISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLAL    141 - 210
STLALYVAVVNVHS                                                            211 - 224
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20538592 2010 Transmembrane protein 147 (TMEM147) is a novel component of the Nicalin-NOMO protein complex.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.