Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.58
PubTator Score 0.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.5e-04
Multiple myeloma 1332 5.5e-04
lung cancer 4740 2.4e-03
glioblastoma 5792 2.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.100 2.8e-03
lung cancer 1.200 2.4e-03
Multiple myeloma 1.444 5.5e-04
ovarian cancer 1.600 1.5e-04

Gene RIF (1)

AA Sequence

MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGE      1 - 70
FMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSN     71 - 140
ISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLAL    141 - 210
STLALYVAVVNVHS                                                            211 - 224
//

Text Mined References (8)

PMID Year Title