Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.58
PubTator Score 11.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.300 0.000
glioblastoma 1.600 0.000
osteosarcoma 1.513 0.000
astrocytoma 1.100 0.010
juvenile dermatomyositis 1.379 0.000
lung cancer 1.100 0.027
diabetes mellitus -1.200 0.017
subependymal giant cell astrocytoma 1.506 0.008
ovarian cancer 2.000 0.000
dermatomyositis 1.300 0.003

Synonym

Accession Q9BVK6 Q14437 Q8WZ61
Symbols p25
GMP25
p24a2
HSGP25L2G
p24alpha2

Gene

 GO Function (1)

 GWAS Trait (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with transmembrane emp24 protein transport domain containing 9 (TMED9) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYD      1 - 70
KQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVH     71 - 140
LDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQ    141 - 210
TLILVAIGVWQMRHLKSFFEAKKLV                                                 211 - 235
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21545355 2011 Syntaxin 17 cycles between the ER and ERGIC and is required to maintain the architecture of ERGIC and Golgi.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19948005 2010 p28, a novel ERGIC/cis Golgi protein, required for Golgi ribbon formation.
19296914 2009 Arf GAP2 is positively regulated by coatomer and cargo.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18287528 2008 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.
16940185 2006 Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.
More...