Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.58
PubTator Score 11.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.100 9.6e-03
dermatomyositis 1.300 2.8e-03
diabetes mellitus -1.200 1.7e-02
glioblastoma 1.600 2.7e-04
juvenile dermatomyositis 1.379 6.1e-15
lung cancer 1.100 2.7e-02
osteosarcoma 1.513 3.3e-05
ovarian cancer 2.000 4.1e-05
psoriasis 1.300 2.2e-04
subependymal giant cell astrocytoma 1.506 8.1e-03

 GO Function (1)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYD      1 - 70
KQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVH     71 - 140
LDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQ    141 - 210
TLILVAIGVWQMRHLKSFFEAKKLV                                                 211 - 235
//

Text Mined References (25)

PMID Year Title