Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.78
PubTator Score 14.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Congenital disorder of glycosylation type 1H 1 0.0 0.0
Disease Target Count
Depressive disorder 409
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 2.2e-06
ovarian cancer 8520 1.8e-05
Multiple myeloma 1332 1.2e-04
lung cancer 4740 4.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 3.399 1.7
Disease Target Count Z-score Confidence
Polycystic liver disease 16 4.036 2.0
protein-losing enteropathy 12 3.793 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.2e-06
lung cancer 1.900 4.3e-03
Multiple myeloma 1.928 1.2e-04
ovarian cancer 1.900 1.8e-05

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MAALTIATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPF      1 - 70
FAWFEYILSHVAKYFDQEMLNVHNLNYSSSRTLLFQRFSVIFMDVLFVYAVRECCKCIDGKKVGKELTEK     71 - 140
PKFILSVLLLWNFGLLIVDHIHFQYNGFLFGLMLLSIARLFQKRHMEGAFLFAVLLHFKHIYLYVAPAYG    141 - 210
VYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLVSALSLGPFLALNQLPQVFSRLFPFKRGLCHAY    211 - 280
WAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTPLATLICTLIAILPSIF    281 - 350
CLWFKPQGPRGFLRCLTLCALSSFMFGWHVHEKAILLAILPMSLLSVGKAGDASIFLILTTTGHYSLFPL    351 - 420
LFTAPELPIKILLMLLFTIYSISSLKTLFRKEKPLFNWMETFYLLGLGPLEVCCEFVFPFTSWKVKYPFI    421 - 490
PLLLTSVYCAVGITYAWFKLYVSVLIDSAIGKTKKQ                                      491 - 526
//

Text Mined References (21)

PMID Year Title