Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
R01 Count 7
Funding $2,903,172.2
PubMed Score 11.52
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor -1.100 0.028
acute quadriplegic myopathy 1.169 0.000
tuberculosis 1.800 0.000
ovarian cancer 1.600 0.000

Gene RIF (6)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20509867 The upregulation of VHZ levels in primary human cancers supports the clinical relevance of this protein in cancers
20453000 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15201283 the smallest active protein-tyrosine phosphatase yet (only 16 kDa) belongs to the group of small Vaccinia virus VH1-related dual specific phosphatases; gene is located on human chromosome 1q23.1 and consists of only two coding exons
15147733 DUSP23 showed distinctive phosphatase activity toward p-nitrophenyl phosphate, as well as oligopeptides containing phospho-tyrosine and phospho-threonine residues. Furthermore, DUSP23 could dephosphorylate p44ERK1 but not p38 and p54SAPKbeta in vitro

AA Sequence

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA      1 - 70
PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK     71 - 140
AVFQFYQRTK                                                                141 - 150
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
21787189 2011 Interstitial lung disease in gefitinib-treated Japanese patients with non-small-cell lung cancer: genome-wide analysis of genetic data.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20509867 2010 VHZ is a novel centrosomal phosphatase associated with cell growth and human primary cancers.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...