Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.35
PubTator Score 2.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.049 8.9e-08
colon cancer 1.700 4.2e-04
group 3 medulloblastoma 1.100 1.5e-02
intraductal papillary-mucinous adenoma (... 1.100 5.5e-03
lung cancer 1.100 4.5e-04
malignant mesothelioma 1.300 3.2e-06
Multiple myeloma 1.339 2.9e-04
ovarian cancer 2.300 6.8e-06
psoriasis 2.000 1.0e-04

 GO Function (1)

Gene RIF (3)

AA Sequence

MTANRLAESLLALSQQEELADLPKDYLLSESEDEGDNDGERKHQKLLEAISSLDGKNRRKLAERSEASLK      1 - 70
VSEFNVSSEGSGEKLVLADLLEPVKTSSSLATVKKQLSRVKSKKTVELPLNKEEIERIHREVAFNKTAQV     71 - 140
LSKWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLLHKNKQPVTDPLLTPVEKA    141 - 210
SLRAMSLEEAKMRRAELQRARALQSYYEAKARREKKIKSKKYHKVVKKGKAKKALKEFEQLRKVNPAAAL    211 - 280
EELEKIEKARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLSKNKELTQKLQVASESEEEEGGT    281 - 350
EDVEELLVPDVVNEVQMNADGPNPWMLRSCTSDTKEAATQEDPEQLPELEAHGVSESEGEERPVAEEEIL    351 - 420
LREFEERRSLRKRSELSQDAEPAGSQETKDSGSQEVLSELRVLSQKLKENHQSRKQKASSEGTIPQVQRE    421 - 490
EPAPEEEEPLLLQRPERVQTLEELEELGKEECFQNKELPRPVLEGQQSERTPNNRPDAPKEKKKKEQMID    491 - 560
LQNLLTTQSPSVKSLAVPTIEELEDEEERNHRQMIKEAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPG    561 - 630
WGEWGGVGLKPSAKKRRRFLIKAPEGPPRKDKNLPNVIINEKRNIHAAAHQVRVLPYPFTHHWQFERTIQ    631 - 700
TPIGSTWNTQRAFQKLTTPKVVTKPGHIINPIKAEDVGYRSSSRSDLSVIQRNPKRITTRHKKQLKKCSV    701 - 770
D//

Text Mined References (33)

PMID Year Title