Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.42
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.0e-04
colon cancer 1478 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bowen-Conradi syndrome 16 6.309 3.2
Progeria 25 4.157 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer 1.200 1.9e-02
osteosarcoma -1.013 2.0e-04

Synonym

Accession Q9BVI4 Q8N2S5 Q96I14 NOC4 protein homolog
Symbols NOC4
NET49
UTP19

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Function (1)

AA Sequence

MEREPGAAGVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQ      1 - 70
LPSEEMVMTGSQGATRKYKVWMRHRYHSCCNRLGELLGHPSFQVKELALSALLKFVQLEGAHPLEKSKWE     71 - 140
GNYLFPRELFKLVVGGLLSPEEDQSLLLSQFREYLDYDDTRYHTMQAAVDAVARVTGQHPEVPPAFWNNA    141 - 210
FTLLSAVSLPRREPTVSSFYVKRAELWDTWKVAHLKEHRRVFQAMWLSFLKHKLPLSLYKKVLLIVHDAI    211 - 280
LPQLAQPTLMIDFLTRACDLGGALSLLALNGLFILIHKHNLEYPDFYRKLYGLLDPSVFHVKYRARFFHL    281 - 350
ADLFLSSSHLPAYLVAAFAKRLARLALTAPPEALLMVLPFICNLLRRHPACRVLVHRPHGPELDADPYDP    351 - 420
GEEDPAQSRALESSLWELQALQRHYHPEVSKAASVINQALSMPEVSIAPLLELTAYEIFERDLKKKGPEP    421 - 490
VPLEFIPAQGLLGRPGELCAQHFTLS                                                491 - 516
//

Text Mined References (10)

PMID Year Title