Property Summary

NCBI Gene PubMed Count 26
PubMed Score 748.71
PubTator Score 26.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.097 3.2e-02
adult high grade glioma -1.100 1.1e-03
Amyotrophic lateral sclerosis 1.040 2.6e-04
atypical teratoid / rhabdoid tumor -1.200 1.6e-03
dermatomyositis 1.800 5.3e-04
group 3 medulloblastoma 1.100 4.7e-04
invasive ductal carcinoma 1.100 7.3e-04
medulloblastoma, large-cell -1.300 9.3e-04
osteosarcoma -1.864 1.4e-04

Protein-protein Interaction (5)

Gene RIF (11)

AA Sequence

MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLEK      1 - 70
IQLRKEGLHEEDGSSEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQ     71 - 140
NIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKLICSEKGKVSE    141 - 210
KSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDSNSQTLQP    211 - 280
ITLELRRRKISKGCEVPLKRPRLDKNSSQEKSKNYSENTDKDLSRRRSSRLSTNGTHEILDPDLVVSDLV    281 - 350
DTDPLQDTLSSTKESEEGQLKSALEAGQVSSALTCHSFGDGSGAAGLELNCPSMGENTMKTEPTSPLVEL    351 - 420
QEISTVEVTNTFKKTDDFGSSNAPAVDLDHKFRCKVVDCLKFFRKAKLLHYHMKYFHGMEKSLEPEESPG    421 - 490
KRHVQTRGPSASDKPSQETLTRKRVSASSPTTKDKEKNKEKKFKEFVRVKPKKKKKKKKKTKPECPCSEE    491 - 560
ISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQ    561 - 630
DVDVTTNPDEELDGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDP    631 - 700
PGQRPGFKYWYDKEWLSRGHMHGLAFLEENYSHQNAKKIVATHQLLGDVQRVIEVLHGLQLKMSILQSRE    701 - 770
HPDLPLWCQPWKQHSGEGRSHFRNIPVTDTRSKEEAPSYRTLNGAVEKPRPLALPLPRSVEESYITSEHC    771 - 840
YQKPRAYYPAVEQKLVVETRGSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS    841 - 910
KKALPEEAPARKLLDRGGEGLLSSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPP    911 - 980
EPLARLPQLKHCIKQLLMDLGKVQQIALCCST                                          981 - 1012
//

Text Mined References (32)

PMID Year Title