Property Summary

NCBI Gene PubMed Count 24
Grant Count 55
R01 Count 50
Funding $6,934,186.61
PubMed Score 660.66
PubTator Score 26.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.864 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
medulloblastoma, large-cell -1.300 0.001
Amyotrophic Lateral Sclerosis 1.040 0.000
active Crohn's disease 1.097 0.032
adult high grade glioma -1.100 0.001
group 3 medulloblastoma 1.100 0.000
invasive ductal carcinoma 1.100 0.001
dermatomyositis 1.800 0.001

Synonym

Accession Q9BVI0 A7E235 B2RB56 E1P5S3 Q566Q2 Q5JWY9 Q66K49 Q9BWV4 Q9BXA3 Q9BZW3 Q9H421 Q9H4J6 Q9NZ22
Symbols NZF
TZP
GLEA2
HCA58
TDRD20A
C20orf104

Gene

PDB

2LDM   3P8D   3Q1J   3QII   3SD4  

Gene RIF (9)

PMID Text
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
24675105 suggests a del(20q)-independent decrease in PHF20 expression in primary myelofibrosis
23797602 Plant homeodomain finger protein 20 (PHF20) maintains NF-kappaB in an active state in the nucleus by inhibiting the interaction between PP2A and p65.
22975685 PHF20 is a novel substrate for PKB and its phosphorylation by PKB plays an important role in tumorigenesis via regulating of p53 mediated signaling.
22864287 Association with PHF20 promotes stabilization and activation of p53 by diminishing Mdm2-mediated p53 ubiquitylation and degradation.
22449972 Data report the crystal structures of the N-terminal Tudor domains of PHF20 and highlight the novel structural features of each domain.
19473719 genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion
18478111 GLEA2 seroreactivity was increased by the time of surgery, decreased after surgery, increased again under radiation, and slightly decreased after radiation
15906353 Survival of patients with GLEA2 antibodies was increased to 17.4 months and for patients with PHF3 antibodies to 14.7 months, as compared to 7.2 months for patients without GLEA2 or PHF3 antibodies in glioblastoma.

AA Sequence

MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLEK      1 - 70
IQLRKEGLHEEDGSSEFQINEQVLACWSDCRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQ     71 - 140
NIVGNARPKETDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKLICSEKGKVSE    141 - 210
KSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDSNSQTLQP    211 - 280
ITLELRRRKISKGCEVPLKRPRLDKNSSQEKSKNYSENTDKDLSRRRSSRLSTNGTHEILDPDLVVSDLV    281 - 350
DTDPLQDTLSSTKESEEGQLKSALEAGQVSSALTCHSFGDGSGAAGLELNCPSMGENTMKTEPTSPLVEL    351 - 420
QEISTVEVTNTFKKTDDFGSSNAPAVDLDHKFRCKVVDCLKFFRKAKLLHYHMKYFHGMEKSLEPEESPG    421 - 490
KRHVQTRGPSASDKPSQETLTRKRVSASSPTTKDKEKNKEKKFKEFVRVKPKKKKKKKKKTKPECPCSEE    491 - 560
ISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQ    561 - 630
DVDVTTNPDEELDGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDP    631 - 700
PGQRPGFKYWYDKEWLSRGHMHGLAFLEENYSHQNAKKIVATHQLLGDVQRVIEVLHGLQLKMSILQSRE    701 - 770
HPDLPLWCQPWKQHSGEGRSHFRNIPVTDTRSKEEAPSYRTLNGAVEKPRPLALPLPRSVEESYITSEHC    771 - 840
YQKPRAYYPAVEQKLVVETRGSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS    841 - 910
KKALPEEAPARKLLDRGGEGLLSSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPP    911 - 980
EPLARLPQLKHCIKQLLMDLGKVQQIALCCST                                          981 - 1012
//

Text Mined References (30)

PMID Year Title
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
24675105 2014 Altered expression of tumor suppressor PHF20 in myeloproliferative neoplasms.
23797602 2013 PHF20 regulates NF-?B signalling by disrupting recruitment of PP2A to p65.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975685 2013 PKB-mediated PHF20 phosphorylation on Ser291 is required for p53 function in DNA damage.
22864287 2012 PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
22449972 2012 Crystal structures of the Tudor domains of human PHF20 reveal novel structural variations on the Royal Family of proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...