Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
Funding $640,969.55
PubMed Score 15.71
PubTator Score 9.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -5.900 0.000
astrocytic glioma -4.100 0.001
ependymoma -4.200 0.002
oligodendroglioma -3.900 0.004
glioblastoma multiforme -3.000 0.000
osteosarcoma 1.091 0.030
cystic fibrosis 3.384 0.000
atypical teratoid / rhabdoid tumor -2.600 0.005
group 4 medulloblastoma -1.900 0.024
adrenocortical carcinoma -2.925 0.000
non-small cell lung carcinoma -1.700 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.003
intraductal papillary-mucinous carcinoma... -1.200 0.004
lung cancer -3.500 0.000
interstitial cystitis 1.300 0.009
lung adenocarcinoma -2.100 0.000
adult high grade glioma -2.300 0.038
pilocytic astrocytoma -3.400 0.000
non primary Sjogren syndrome sicca -1.100 0.015
Breast cancer 3.500 0.012
Pick disease -1.700 0.019
gastric carcinoma 1.300 0.034
ovarian cancer 2.600 0.001
psoriasis -1.200 0.000

Synonym

Accession Q9BVH7 B1AK82
Symbols SIAT7E
SIAT7-E
ST6GalNAcV

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24399302 Sequence data from combined Iranian and US controls and CAD affected individuals provided evidence consistent with potential role of ST6GALNAC5 in coronary artery disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAAESSTQQRPGV      1 - 70
PAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECVIRMNDAPTRGYGRDVGNRTS     71 - 140
LRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLPRLKAFMITRHKML    141 - 210
QFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDEC    211 - 280
TMYLSHERGRKGSHHRFITEKRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF                  281 - 336
//

Text Mined References (13)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24399302 2014 Mutation in ST6GALNAC5 identified in family with coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15843597 2005 The animal sialyltransferases and sialyltransferase-related genes: a phylogenetic approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12668675 2003 Synthesis of disialyl Lewis a (Le(a)) structure in colon cancer cell lines by a sialyltransferase, ST6GalNAc VI, responsible for the synthesis of alpha-series gangliosides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10601645 1999 A novel glycosyltransferase with a polyglutamine repeat; a new candidate for GD1alpha synthase (ST6GalNAc V)(1).
More...