Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.76
PubTator Score 9.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -2.925 1.7e-06
adult high grade glioma -2.300 3.8e-02
astrocytic glioma -4.100 9.6e-04
Astrocytoma, Pilocytic -3.400 7.9e-05
atypical teratoid / rhabdoid tumor -2.600 4.8e-03
Breast cancer 3.500 1.2e-02
cystic fibrosis 3.384 1.2e-07
ependymoma -4.200 2.1e-03
gastric carcinoma 1.300 3.4e-02
glioblastoma -2.300 2.1e-03
group 4 medulloblastoma -1.900 2.4e-02
interstitial cystitis 1.300 8.6e-03
intraductal papillary-mucinous adenoma (... -1.200 3.0e-03
intraductal papillary-mucinous carcinoma... -1.200 4.3e-03
lung adenocarcinoma -2.100 3.6e-17
lung cancer -1.200 2.6e-03
malignant mesothelioma -5.900 3.3e-10
non primary Sjogren syndrome sicca -1.100 1.5e-02
non-small cell lung cancer -1.683 7.7e-13
oligodendroglioma -3.900 3.8e-03
osteosarcoma 1.091 3.0e-02
ovarian cancer 2.600 5.8e-04
Pick disease -1.700 1.9e-02
psoriasis -1.200 1.3e-41

Gene RIF (2)

AA Sequence

MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAAESSTQQRPGV      1 - 70
PAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECVIRMNDAPTRGYGRDVGNRTS     71 - 140
LRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLPRLKAFMITRHKML    141 - 210
QFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDEC    211 - 280
TMYLSHERGRKGSHHRFITEKRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF                  281 - 336
//

Text Mined References (13)

PMID Year Title