Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.37326975843318E-5
diabetes mellitus 1663 0.00436850887739122
group 3 medulloblastoma 2254 0.00437265466474659
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0107911830373461
subependymal giant cell astrocytoma 2287 0.0218753190196973
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0439064431419252
Disease Target Count Z-score Confidence
Motor neuron disease 39 0.0 2.0

Expression

Synonym

Accession Q9BVG4
Symbols CXorf26

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Pig OMA Inparanoid

AA Sequence

MAATSGTDEPVSGELVSVAHALSLPAESYGNDPDIEMAWAMRAMQHAEVYYKLISSVDPQFLKLTKVDDQ      1 - 70
IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRI     71 - 140
QFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEKGADSGEEKEEGINREDK    141 - 210
TDKGGEKGKEADKEINKSGEKAM                                                   211 - 233
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
More...