Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9BVG4
Symbols CXorf26

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MAATSGTDEPVSGELVSVAHALSLPAESYGNDPDIEMAWAMRAMQHAEVYYKLISSVDPQFLKLTKVDDQ      1 - 70
IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRI     71 - 140
QFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEKGADSGEEKEEGINREDK    141 - 210
TDKGGEKGKEADKEINKSGEKAM                                                   211 - 233
//

Text Mined References (13)

PMID Year Title