Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.51
PubTator Score 6.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 1.4e-09
ependymoma 4679 2.3e-09
atypical teratoid/rhabdoid tumor 357 3.4e-07
psoriasis 6694 7.6e-04
osteosarcoma 7950 3.2e-03

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.300 3.4e-07
ependymoma -1.100 2.3e-09
osteosarcoma -1.307 3.2e-03
ovarian cancer 1.100 1.4e-09
psoriasis 1.400 7.6e-04

Gene RIF (10)

AA Sequence

MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEPALAPSLKLAN      1 - 70
IVERYSSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELK     71 - 140
DQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTD    141 - 210
IEQKVQRYSQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQY    211 - 280
TIWKSLFQDIHPVPAALTLDPGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGV    281 - 350
HYWEVVVAEKTQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL    351 - 420
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI                   421 - 475
//

Text Mined References (18)

PMID Year Title