Property Summary

NCBI Gene PubMed Count 17
Grant Count 11
Funding $3,629,630.8
PubMed Score 6.96
PubTator Score 6.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma -1.307 0.003
posterior fossa group A ependymoma -1.200 0.000
atypical teratoid/rhabdoid tumor -1.300 0.000
ovarian cancer 1.100 0.000

Gene RIF (9)

PMID Text
26488816 TRIM62 is a CARD9-binding partner. TRIM62 facilitated K27-linked poly-ubiquitination of CARD9.
25261235 DEAR1 is important in the regulation of the breast tumor microenvironment, polarity, and epithelial-mesenchymal transition. [Review]
25248926 Low TRIM62 levels, consistent with a tumor suppressor role, represent an independent adverse prognostic factor in AML.
23838884 results provide compelling evidence that DEAR1 is a critical tumor suppressor involved in multiple human cancers and provide a novel paradigm for regulation of TGF-beta-induced EMT through DEAR1's regulation of SMAD3 protein levels
23402750 these data indicate that TRIM62, a cytoplasmic protein, is a RING finger domain-dependent E3 ubiquitin ligase that catalyzes self-ubiquitination both in vitro and in vivo.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536326 The evidence for the genetic alteration and loss of expression of DEAR1 in breast cancer and for the functional role of DEAR1 in the dominant regulation of acinar morphogenesis in 3D culture
19536324 DEAR1 is a predictive biomarker for early onset breast cancer.
18248090 Gene silencing of endogenously expressed TRIM62 inhibits viral release, suggesting the interaction between HIV-1 Gag and TRIM62

AA Sequence

MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEPALAPSLKLAN      1 - 70
IVERYSSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELK     71 - 140
DQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTD    141 - 210
IEQKVQRYSQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQY    211 - 280
TIWKSLFQDIHPVPAALTLDPGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGV    281 - 350
HYWEVVVAEKTQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL    351 - 420
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI                   421 - 475
//

Text Mined References (17)

PMID Year Title
26488816 2015 Ubiquitin Ligase TRIM62 Regulates CARD9-Mediated Anti-fungal Immunity and Intestinal Inflammation.
25261235 2014 DEAR1, a novel tumor suppressor that regulates cell polarity and epithelial plasticity.
25248926 2015 Loss of TRIM62 expression is an independent adverse prognostic factor in acute myeloid leukemia.
23838884 2013 DEAR1 is a chromosome 1p35 tumor suppressor and master regulator of TGF-?-driven epithelial-mesenchymal transition.
23402750 2013 Characterization of TRIM62 as a RING finger E3 ubiquitin ligase and its subcellular localization.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19536326 2009 DEAR1 is a dominant regulator of acinar morphogenesis and an independent predictor of local recurrence-free survival in early-onset breast cancer.
19536324 2009 A new tumor suppressor that regulates tissue architecture.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
More...