Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.93
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 4.4e-13
ovarian cancer 8520 1.5e-10
Multiple myeloma 1332 1.0e-04
astrocytoma 1146 3.3e-03
breast carcinoma 1638 2.2e-02

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 3.3e-03
breast carcinoma 1.500 2.2e-02
lung adenocarcinoma -1.100 4.4e-13
Multiple myeloma 1.185 1.0e-04
ovarian cancer -1.500 1.5e-10

Gene RIF (2)

AA Sequence

MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAPVDVLTQIGRSVRGTLDAWIG      1 - 70
PETMHLVSESSSQVLWAISSAISVAFFALSGIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALV     71 - 140
VYWLLSLLLGLVLALLGRILWGLKLVIFLAGFVALMRSVPDPSTRALLLLALLILYALLSRLTGSRASGA    141 - 210
QLEAKVRGLERQVEELRWRQRRAAKGARSVEEE                                         211 - 243
//

Text Mined References (13)

PMID Year Title