Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.93
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.185 0.000
astrocytoma 1.300 0.003
breast carcinoma 1.500 0.022
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9BVC6
Symbols

Gene

Gene RIF (2)

PMID Text
23542032 MG23 plays a protective role against UVC by accumulating alphaBC in the close vicinity of the ER
20060811 MG23 is an essential component of ER-generated lethal signals provoked upon DNA damage, specifying cell fate under pathophysiological conditions.

AA Sequence

MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAPVDVLTQIGRSVRGTLDAWIG      1 - 70
PETMHLVSESSSQVLWAISSAISVAFFALSGIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALV     71 - 140
VYWLLSLLLGLVLALLGRILWGLKLVIFLAGFVALMRSVPDPSTRALLLLALLILYALLSRLTGSRASGA    141 - 210
QLEAKVRGLERQVEELRWRQRRAAKGARSVEEE                                         211 - 243
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23542032 2013 Protective role of the endoplasmic reticulum protein mitsugumin23 against ultraviolet C-induced cell death.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23269685 2013 Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20060811 2010 Facilitation of DNA damage-induced apoptosis by endoplasmic reticulum protein mitsugumin23.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...