Property Summary

NCBI Gene PubMed Count 22
Grant Count 81
R01 Count 60
Funding $6,845,504.01
PubMed Score 401.44
PubTator Score 38.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession Q9BVC4 B3KMM4 B4DY00 D3DU88 Q5M800 Q86Y18 Q8WUI5 Q9HA66 Q9UJV6 TORC subunit LST8
Symbols GBL
LST8
POP3
WAT1
GbetaL

Gene

PDB

4JSN   4JSP   4JSV   4JSX   4JT5   4JT6   5FLC  

Gene RIF (9)

PMID Text
26787466 Data suggest MTMR3 has multiple functions in regulation of autophagy; one mechanism appears to be direct interaction between MTMR3 and mTORC1 (MTOR, mLST8, raptor) which inhibits phosphorylation activity of mTORC1; MTMR3 is localized to Golgi apparatus.
25906254 MLST8 upregulation may contribute to tumor progression.
24337580 Amino acids promote mTORC1 activation without altering Rag GTP charging.
23594158 The results obtained indicate that mLST8 bridges between CAD and mTOR, and plays a role in the signaling mechanism where CAD is regulated in the mTOR pathway through the association with mLST8.
23423739 MLST8 polymorphism is associated with gastric cancer.
22258093 An essential role of mTORC1 in autophagy inhibition in cell-free system in which, membrane association of Barkor/Atg14(L), a specific autophagosome-binding protein, is suppressed by cytosol from nutrient-rich medium, is shown.
21454807 Adiponectin induces vascular smooth muscle cell differentiation via repression of mammalian target of rapamycin complex 1 and FoxO4
21321085 results suggest that GRp58/ERp57 is involved in the assembly of mTORC1 and positively regulates mTORC1 signaling at the cytosol and the cytosolic side of the endoplasmic reticulum
21283628 show that E2F1 is capable of inducing growth by regulating mTORC1 activity

AA Sequence

MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDL      1 - 70
NSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQ     71 - 140
AELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQL    141 - 210
IPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSG    211 - 280
DSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG                            281 - 326
//

Text Mined References (32)

PMID Year Title
26787466 2016 The PtdIns3-phosphatase MTMR3 interacts with mTORC1 and suppresses its activity.
25906254 2015 mLST8 Promotes mTOR-Mediated Tumor Progression.
24337580 2014 Amino acids activate mammalian target of rapamycin (mTOR) complex 1 without changing Rag GTPase guanyl nucleotide charging.
24036451 2013 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
23636326 2013 mTOR kinase structure, mechanism and regulation.
23594158 2013 Association of CAD, a multifunctional protein involved in pyrimidine synthesis, with mLST8, a component of the mTOR complexes.
23423739 2013 Genetic variations of mTORC1 genes and risk of gastric cancer in an Eastern Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22258093 2012 Reconstitution of leucine-mediated autophagy via the mTORC1-Barkor pathway in vitro.
21454807 2011 Adiponectin induces vascular smooth muscle cell differentiation via repression of mammalian target of rapamycin complex 1 and FoxO4.
More...