Property Summary

NCBI Gene PubMed Count 22
PubMed Score 429.27
PubTator Score 38.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 1.3e-04

 GWAS Trait (1)

Protein-protein Interaction (13)

Gene RIF (9)

AA Sequence

MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDL      1 - 70
NSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQ     71 - 140
AELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQL    141 - 210
IPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSG    211 - 280
DSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG                            281 - 326
//

Text Mined References (32)

PMID Year Title