Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.87
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.125 3.1e-03
atypical teratoid / rhabdoid tumor 1.200 6.2e-03
Breast cancer 1.300 3.8e-07
colon cancer 1.400 8.3e-03
group 3 medulloblastoma 1.700 1.9e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-03
lung cancer 1.200 3.0e-03
malignant mesothelioma 1.600 8.8e-07
medulloblastoma, large-cell 1.500 4.7e-04
nasopharyngeal carcinoma 1.400 2.6e-05
non-small cell lung cancer 1.222 4.6e-13
osteosarcoma -1.060 3.0e-02
ovarian cancer 1.400 4.7e-04
primitive neuroectodermal tumor 1.500 5.8e-04

 GO Function (1)

Protein-protein Interaction (6)

Gene RIF (4)

AA Sequence

MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGHSLVIRGDKDE      1 - 70
QAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKK     71 - 140
LLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEFDYEMKLLNHV    141 - 210
TQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNA    211 - 280
VKFNLAEFQEVWQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE    281 - 350
EDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRPIS                               351 - 393
//

Text Mined References (13)

PMID Year Title