Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.44
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 GO Function (1)

Gene RIF (4)

PMID Text
24465681 E2F-dependent expression of DSCC1 confers anti-apoptotic properties in colorectal cancer cells.
20826785 Stable interaction between the human proliferating cell nuclear antigen loader complex Ctf18-replication factor C (RFC) and DNA polymerase {epsilon} is mediated by the cohesion-specific subunits, Ctf18, Dcc1, and Ctf8.
12930902 The alternative Ctf18-Dcc1-Ctf8-replication factor C complex required for sister chromatid cohesion loads proliferating cell nuclear antigen onto DNA.
12766176 hCTF18, hCTF8, and hDCC1 interact with each other as well as with the p38 subunit of RFC

AA Sequence

MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGHSLVIRGDKDE      1 - 70
QAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKK     71 - 140
LLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEFDYEMKLLNHV    141 - 210
TQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNA    211 - 280
VKFNLAEFQEVWQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE    281 - 350
EDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRPIS                               351 - 393
//

Text Mined References (13)

PMID Year Title
24465681 2014 Overexpression of cohesion establishment factor DSCC1 through E2F in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20826785 2010 Stable interaction between the human proliferating cell nuclear antigen loader complex Ctf18-replication factor C (RFC) and DNA polymerase {epsilon} is mediated by the cohesion-specific subunits, Ctf18, Dcc1, and Ctf8.
19907496 2009 Cohesin acetylation speeds the replication fork.
18499658 2008 Studies with the human cohesin establishment factor, ChlR1. Association of ChlR1 with Ctf18-RFC and Fen1.
16682347 2006 Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...