Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1214.07
PubTator Score 288.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 5.2e-19
osteosarcoma 7950 4.4e-05
pituitary cancer 1972 7.2e-05
interstitial cystitis 2312 1.8e-04
psoriasis 6694 1.1e-03
sonic hedgehog group medulloblastoma 467 1.4e-03
spina bifida 1074 4.1e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.39 1.7
Anal fistula 6 3.202 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis 1.300 1.8e-04
lung carcinoma 1.200 5.2e-19
osteosarcoma 1.633 4.4e-05
pituitary cancer -1.600 7.2e-05
psoriasis 1.800 1.1e-03
sonic hedgehog group medulloblastoma -1.300 1.4e-03
spina bifida -1.084 4.1e-02

Gene RIF (3)

AA Sequence

MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQH      1 - 70
AATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFV     71 - 140
DALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPK    141 - 210
GNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVS    211 - 280
RIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVE    281 - 350
FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAK    351 - 420
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP                                    421 - 458
//

Text Mined References (13)

PMID Year Title