Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1128.18
PubTator Score 288.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.22825668830723E-19
osteosarcoma 7933 4.39081015606563E-5
pituitary cancer 1972 7.17267321920337E-5
interstitial cystitis 2299 1.76960101533325E-4
psoriasis 6685 0.00107672512737701
sonic hedgehog group medulloblastoma 1482 0.00139223692283739
spina bifida 1064 0.0412732929548181
Disease Target Count Z-score Confidence
Cancer 2346 3.334 1.7
Anal fistula 4 3.274 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.800 0.001
osteosarcoma 1.633 0.000
interstitial cystitis 1.300 0.000
sonic hedgehog group medulloblastoma -1.300 0.001
lung carcinoma 1.200 0.000
spina bifida -1.084 0.041
pituitary cancer -1.600 0.000

Synonym

Accession Q9BVA6 O75406
Symbols HYPE
HIP13
UNQ3041

Gene

PDB

4U04   4U07   4U0S   4U0U   4U0Z  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
26604261 We first demonstrate efficient enrichment and fast visualization of potential HYPE substrates in cell lysates by in-gel fluorescence, followed by robust identification via shotgun proteomics on a QExactive mass spectrometer
25601083 HYPE is an unfolded protein response regulator.

AA Sequence

MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQH      1 - 70
AATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFV     71 - 140
DALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPK    141 - 210
GNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVS    211 - 280
RIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVE    281 - 350
FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAK    351 - 420
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP                                    421 - 458
//

Text Mined References (11)

PMID Year Title
26604261 2016 Global Profiling of Huntingtin-associated protein E (HYPE)-Mediated AMPylation through a Chemical Proteomic Approach.
25601083 2015 A novel link between Fic (filamentation induced by cAMP)-mediated adenylylation/AMPylation and the unfolded protein response.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22266942 2012 Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins.
19362538 2009 The fic domain: regulation of cell signaling by adenylylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...