Property Summary

NCBI Gene PubMed Count 10
Grant Count 40
R01 Count 19
Funding $6,283,029.34
PubMed Score 1128.18
PubTator Score 288.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.800 0.001
osteosarcoma 1.633 0.000
interstitial cystitis 1.300 0.000
sonic hedgehog group medulloblastoma -1.300 0.001
lung carcinoma 1.200 0.000
spina bifida -1.084 0.041
pituitary cancer -1.600 0.000

Gene RIF (2)

PMID Text
26604261 We first demonstrate efficient enrichment and fast visualization of potential HYPE substrates in cell lysates by in-gel fluorescence, followed by robust identification via shotgun proteomics on a QExactive mass spectrometer
25601083 HYPE is an unfolded protein response regulator.

AA Sequence

MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQH      1 - 70
AATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFV     71 - 140
DALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPK    141 - 210
GNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVS    211 - 280
RIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVE    281 - 350
FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAK    351 - 420
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP                                    421 - 458
//

Text Mined References (11)

PMID Year Title
26604261 2016 Global Profiling of Huntingtin-associated protein E (HYPE)-Mediated AMPylation through a Chemical Proteomic Approach.
25601083 2015 A novel link between Fic (filamentation induced by cAMP)-mediated adenylylation/AMPylation and the unfolded protein response.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22266942 2012 Adenylylation control by intra- or intermolecular active-site obstruction in Fic proteins.
19362538 2009 The fic domain: regulation of cell signaling by adenylylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...