Property Summary

NCBI Gene PubMed Count 25
Grant Count 4
R01 Count 4
Funding $313,565.5
PubMed Score 14.12
PubTator Score 15.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 5.500 0.000
cystic fibrosis -2.537 0.000
non-small cell lung cancer 1.017 0.000
colon cancer -1.900 0.023
lung cancer 4.900 0.000
lung adenocarcinoma 1.400 0.003
Breast cancer -3.500 0.000
lung carcinoma 1.700 0.000
breast carcinoma -1.700 0.000

Gene RIF (17)

PMID Text
26331477 off-target, non-immune mediated effects of the mTOR-inhibitor everolimus on the podocyte cytoskeleton might involve regulation of microtubules, revealing a potential novel role of TUBB2B and DCDC2 in glomerular podocyte development
24392928 The present study confirms that mutations in tubulin genes are responsible for complex brain malformation.
23826228 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
23495813 The association of polymicrogyria with thin or absent corpus callosum, dysmorphic basal ganglia, brainstem and vermis hypoplasia is highly likely to result from mutations in TUBB2B.
23361065 The TUBB2B and TUBA1 coding regions have been sequenced in patients with cortical malformations associated with these genes.
23001566 Congenital fibrosis of the extraocular muscles and intellectual disability segregate with a heterozygous mutation in TUBB2B.
22591407 Brain malformations are associated with mutations in the beta-tubulin gene TUBB2B, supporting its critical role in migration/organization and axon guidance processes.
22333901 Three new TUBB2B mutations have been identified in three unrelated patients with a diffuse and rather symmetrical cortical abnormality.
22174317 HIV-1 Tat (specifically, amino acids 38-72), enhances tubulin polymerization and triggers the mitochondrial pathway to induce T cell apoptosis as shown in vitro by the release of cytochrome c from isolated mitochondria
19996274 Studies show that BFBTS bound and modified beta-tubulin at residue Cys12, forming beta-tubulin-SS-fluorobenzyl.
More...

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (29)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26331477 2015 Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression.
24392928 2014 Brain malformations and mutations in ?- and ?-tubulin genes: a review of the literature and description of two new cases.
23495813 2014 Polymicrogyria with dysmorphic basal ganglia? Think tubulin!
23361065 2013 Overlapping cortical malformations and mutations in TUBB2B and TUBA1A.
23001566 2012 An inherited TUBB2B mutation alters a kinesin-binding site and causes polymicrogyria, CFEOM and axon dysinnervation.
22591407 2012 A novel mutation in the ?-tubulin gene TUBB2B associated with complex malformation of cortical development and deficits in axonal guidance.
22333901 2012 Symmetric polymicrogyria and pachygyria associated with TUBB2B gene mutations.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
More...