Property Summary

Ligand Count 11
NCBI Gene PubMed Count 27
PubMed Score 14.64
PubTator Score 15.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung carcinoma 2843 5.5e-26
breast carcinoma 1637 1.3e-24
Breast cancer 3577 5.9e-16
malignant mesothelioma 3232 3.9e-10
lung cancer 4740 4.2e-07
cystic fibrosis 1695 3.5e-06
lung adenocarcinoma 2716 2.6e-03
colon cancer 1478 5.9e-03
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -3.500 5.9e-16
breast carcinoma -1.700 1.3e-24
colon cancer -1.700 5.9e-03
cystic fibrosis -2.537 3.5e-06
lung adenocarcinoma 1.400 2.6e-03
lung cancer 4.000 4.2e-07
lung carcinoma 1.700 5.5e-26
malignant mesothelioma 5.500 3.9e-10
non-small cell lung cancer 1.017 1.7e-04

Gene RIF (19)

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATADEQGEFEEEEGEDEA                                                 421 - 445
//

Text Mined References (31)

PMID Year Title