Property Summary

NCBI Gene PubMed Count 21
Grant Count 22
R01 Count 20
Funding $1,148,767.24
PubMed Score 8.19
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis 1.900 0.000
osteosarcoma -1.326 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
lung cancer 1.800 0.023
pediatric high grade glioma -1.200 0.000
ovarian cancer 1.100 0.000

Pathway (1)

Gene RIF (6)

PMID Text
25521379 results reveal unexpected functions for KATNB1 in regulating overall centriole, mother centriole, and cilia number, and as an essential gene for normal Hedgehog signaling during neocortical development
25521378 results provide insight into the mechanisms by which KATNB1 mutations cause human cerebral cortical malformations, demonstrating its fundamental role during brain development.
25280067 results suggest that variants in the KATNB1 gene are not commonly associated with OAT infertility in Australian men
20508983 Observational study of gene-disease association. (HuGE Navigator)
19261606 Cul3-deficient cells or Ctb9/KLHDC5-deficient cells show an increase in p60/katanin levels, indicating that Cul3/Ctb9/KLHDC5 is required for efficient p60/katanin removal
18490357 LAPSER1 C terminal domain inhibits katanin(p80/p60)-mediated microtubule severing in vitro.

AA Sequence

MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVR      1 - 70
LNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCV     71 - 140
FRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSD    141 - 210
RTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAI    211 - 280
CNDQLIGVAFSQSNVSSYVVDLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRV    281 - 350
KQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKP    351 - 420
SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQ    421 - 490
IRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVL    491 - 560
PQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQLKSISGLV    561 - 630
KSKSGLSGRHGSTFRELHLLMASLD                                                 631 - 655
//

Text Mined References (24)

PMID Year Title
25521379 2014 Katanin p80 regulates human cortical development by limiting centriole and cilia number.
25521378 2014 Mutations in KATNB1 cause complex cerebral malformations by disrupting asymmetrically dividing neural progenitors.
25280067 2014 KATNB1 in the human testis and its genetic variants in fertile and oligoasthenoteratozoospermic infertile men.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19261606 2009 The Cul3/Klhdc5 E3 ligase regulates p60/katanin and is required for normal mitosis in mammalian cells.
18490357 2008 LAPSER1/LZTS2: a pluripotent tumor suppressor linked to the inhibition of katanin-mediated microtubule severing.
More...