Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.66
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 2.8e-03
atypical teratoid / rhabdoid tumor -1.500 8.9e-07
glioblastoma -1.400 2.9e-05
lung cancer 1.800 2.3e-02
malignant mesothelioma 1.300 1.5e-06
osteosarcoma -1.326 7.5e-05
ovarian cancer 1.100 3.1e-05
psoriasis 1.900 2.7e-05

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVR      1 - 70
LNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCV     71 - 140
FRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSD    141 - 210
RTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAI    211 - 280
CNDQLIGVAFSQSNVSSYVVDLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRV    281 - 350
KQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKP    351 - 420
SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQ    421 - 490
IRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVL    491 - 560
PQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQLKSISGLV    561 - 630
KSKSGLSGRHGSTFRELHLLMASLD                                                 631 - 655
//

Text Mined References (28)

PMID Year Title