Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.22
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 1.1e-06
medulloblastoma, large-cell 6241 1.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.000 1.1e-06
medulloblastoma, large-cell 1.400 1.0e-03

Synonym

Accession Q9BV99 B3KUW0 D3DWY8
Symbols HSPC295

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MDPPAEKPGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGP      1 - 70
LASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPL     71 - 140
CANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSLRPSSSPGPRATEAQPWVEPGYWESWPS    141 - 210
RSSSILEEACRQFQDTLQECWDLDRQASDSLAQAEQVLSSAGPTSSFVF                         211 - 259
//

Text Mined References (7)

PMID Year Title