Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.22
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
medulloblastoma, large-cell 1.400 0.001

Synonym

Accession Q9BV99 B3KUW0 D3DWY8
Symbols HSPC295

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MDPPAEKPGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGP      1 - 70
LASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPL     71 - 140
CANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSLRPSSSPGPRATEAQPWVEPGYWESWPS    141 - 210
RSSSILEEACRQFQDTLQECWDLDRQASDSLAQAEQVLSSAGPTSSFVF                         211 - 259
//

Text Mined References (7)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.