Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.5194145066029E-7
psoriasis 6685 6.81411223834079E-6
ovarian cancer 8492 7.56601781485813E-6
osteosarcoma 7933 2.86620722314287E-5
group 3 medulloblastoma 2254 2.00706353982247E-4

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
18976975 Knockdown of zinc finger protein 747 (ZNF747) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETY      1 - 70
GHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRP     71 - 140
NCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG                       141 - 191
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.