Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 1.5e-07
osteosarcoma 7950 3.8e-07
psoriasis 6694 6.8e-06
ovarian cancer 8520 7.6e-06
group 3 medulloblastoma 4104 2.0e-04

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.0e-04
malignant mesothelioma 1.800 1.5e-07
osteosarcoma -2.304 3.8e-07
ovarian cancer 1.500 7.6e-06
psoriasis -3.600 6.8e-06

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETY      1 - 70
GHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRP     71 - 140
NCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG                       141 - 191
//

Text Mined References (6)

PMID Year Title