Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.24
PubTator Score 6.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.280 0.000
glioblastoma 1.100 0.013
atypical teratoid / rhabdoid tumor 1.300 0.003
non primary Sjogren syndrome sicca 1.300 0.021

Synonym

Accession Q9BV94 B4DTG9 Q6GU33 Q6IA89 Q6UWZ4 Q9H4U0 Q9H886 Q9NTL9 Q9NVE6
Symbols C20orf31
C20orf49
bA4204.1

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
25092655 Glycoproteins mannose trimming from Man9GlcNAc2 to Man8GlcNAc2 is conducted mainly by EDEM2.
24910992 EDEM2 and OS-9 are required for ER-associated degradation of non-glycosylated sonic hedgehog
20802025 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15579471 EDEM2 regulates endoplasmic reticulum-associated glycoprotein degradation
15537790 Overexpression of EDEM2 accelerates the degradation of misfolded alpha1-antitrypsin, indicating that the protein is involved in endoplasmic reticulum associated degradation.
15537790 Degrades misfolded alpha1-antitrypsin in the ER.

AA Sequence

MPFRLLIPLGLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDELRPLTCDGHDT      1 - 70
WGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDSVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEV     71 - 140
EAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTG    141 - 210
DPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMF    211 - 280
LEYNKAIRNYTRFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLP    281 - 350
EFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK    351 - 420
LDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQR    421 - 490
LKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSPENHDQARERKPAKQKVPLLSCPS    491 - 560
QPFTSKLALLGQVFLDSS                                                        561 - 578
//

Text Mined References (19)

PMID Year Title
25092655 2014 EDEM2 initiates mammalian glycoprotein ERAD by catalyzing the first mannose trimming step.
24910992 2014 EDEM2 and OS-9 are required for ER-associated degradation of non-glycosylated sonic hedgehog.
24200403 2014 The role of EDEM2 compared with EDEM1 in ricin transport from the endoplasmic reticulum to the cytosol.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20802025 2010 Genome-wide association study identifies novel loci for plasma levels of protein C: the ARIC study.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
17499246 2007 Glycoprotein folding and the role of EDEM1, EDEM2 and EDEM3 in degradation of folding-defective glycoproteins.
15579471 2005 A novel stress-induced EDEM variant regulating endoplasmic reticulum-associated glycoprotein degradation.
More...