Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.74
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.073 0.004
astrocytoma -1.200 0.018
group 4 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.000
lung cancer 1.800 0.000
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.200 0.000
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.100 0.010
ovarian cancer 1.800 0.000

Synonym

Gene

Gene RIF (1)

PMID Text
25300797 Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas.

AA Sequence

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI      1 - 70
QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK             71 - 132
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25300797 2014 Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
16728641 2006 A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.