Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.25
PubTator Score 9.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.4e-06
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 2.4e-02
ovarian cancer 2.300 1.4e-06

Gene RIF (7)

AA Sequence

MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA      1 - 70
GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH     71 - 140
LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL    141 - 210
PDEIYHVYSFALR                                                             211 - 223
//

Text Mined References (22)

PMID Year Title