Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.25
PubTator Score 9.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.4e-06
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 1.2

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 2.4e-02
ovarian cancer 2.300 1.4e-06

Synonym

Accession Q9BV86 A8K4J2 A8K8G7 Q5SZB9 Q9UI28
Symbols NRMT
NRMT1
NTM1A
AD-003
HOMT1A
C9orf32
METTL11A

Gene

PANTHER Protein Class (2)

PDB

2EX4   5CVD   5CVE   5E1B   5E1D   5E1M   5E1O   5E2A   5E2B  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA      1 - 70
GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH     71 - 140
LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL    141 - 210
PDEIYHVYSFALR                                                             211 - 223
//

Text Mined References (22)

PMID Year Title