Property Summary

NCBI Gene PubMed Count 16
Grant Count 17
R01 Count 10
Funding $2,723,258.06
PubMed Score 9.15
PubTator Score 9.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.024
ovarian cancer 2.300 0.000

Gene RIF (6)

PMID Text
26543159 NRMT1 adopts a core methyltransferase fold that resembles DOT1L and PRMT but not SET domain family histone methyltransferases.
25843235 These studies position the NRMT1 knockout mouse as a useful new system for studying the effects of genomic instability and defective DNA damage repair on organismal and tissue-specific aging.
25771539 kinetic mechanism of NTMT1
24090352 Concurrent expression of NRMT1 and NRMT2 accelerates the production of trimethylation, and we propose that NRMT2 activates NRMT1 by priming its substrates for trimethylation.
22769851 Peptide methylation assays and substrate immunoprecipitations demonstrate that the canonical M-X-P-K methylation motif is not the only one recognized by NRMT.
20668449 discovery of the first alpha-N-methyltransferase, which we named N-terminal RCC1 methyltransferase (NRMT).

AA Sequence

MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA      1 - 70
GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH     71 - 140
LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL    141 - 210
PDEIYHVYSFALR                                                             211 - 223
//

Text Mined References (21)

PMID Year Title
26543161 2015 Structural basis for substrate recognition by the human N-terminal methyltransferase 1.
26543159 2015 Molecular basis for histone N-terminal methylation by NRMT1.
25843235 2015 NRMT1 knockout mice exhibit phenotypes associated with impaired DNA repair and premature aging.
25771539 2015 Kinetic mechanism of protein N-terminal methyltransferase 1.
24090352 2013 NRMT2 is an N-terminal monomethylase that primes for its homologue NRMT1.
22769851 2012 Substrate specificity of mammalian N-terminal ?-amino methyltransferase NRMT.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21269460 2011 Initial characterization of the human central proteome.
20668449 2010 NRMT is an alpha-N-methyltransferase that methylates RCC1 and retinoblastoma protein.
More...