Property Summary

NCBI Gene PubMed Count 14
PubMed Score 25.38
PubTator Score 9.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dystonia 164 3.275 1.6
Disease Target Count Z-score Confidence
Optic Atrophy 242 3.353 1.7
Osteochondrosis 17 3.029 1.5

Expression

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRG      1 - 70
SDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRT     71 - 140
EAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLR    141 - 210
TINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGG    211 - 280
TMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPL    281 - 350
QDYQSALEASMKPFISSKQILTM                                                   351 - 373
//

Text Mined References (18)

PMID Year Title