Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 4
Funding $671,325.33
PubMed Score 7.38
PubTator Score 4.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.028
psoriasis 1.200 0.001
non primary Sjogren syndrome sicca 1.200 0.015
ovarian cancer 1.100 0.000

Gene RIF (7)

PMID Text
26234677 this results suggest a novel role of RNF126 in promoting Homologous recombination-mediated repair through positive regulation on BRCA1 expression by direct interaction with E2F1.
24981174 RNF126 is recruited to the N-terminal Ubl domain of Bag6 and preferentially ubiquitinates juxtahydrophobic lysine residues on Bag6-associated clients.
24275455 The ubiquitin ligase RNF126 has a role in the retrograde sorting of the CI-MPR.
23418353 RNF126 and Rabring7 play a role in the ubiquitin-dependent sorting and downregulation of membrane receptors.
23277564 identify a unique cofactor, RING finger protein 126 (RNF126), verify its interaction by traditional techniques, and show that it has functional consequences as RNF126 is able to ubiquitylate activation-induced cytidine deaminase
23026136 These findings suggest that RNF126 promotes cancer cell proliferation by targeting p21 for ubiquitin-mediated degradation
22190034 HIV-1 gp120 is identified to have a physical interaction with ring finger protein 126 (RNF126) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQ      1 - 70
HLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHRYGARQPRARLTTRRATGRH     71 - 140
EGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKI    141 - 210
QALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTAT    211 - 280
NPPGLTGVSFSSSSSSSSSSSPSNENATWSPLGRPQPPRPLSNLTL                            281 - 326
//

Text Mined References (17)

PMID Year Title
26234677 2016 RNF126 promotes homologous recombination via regulation of E2F1-mediated BRCA1 expression.
25416956 2014 A proteome-scale map of the human interactome network.
24981174 2014 Cytosolic quality control of mislocalized proteins requires RNF126 recruitment to Bag6.
24275455 2014 The ubiquitin ligase RNF126 regulates the retrograde sorting of the cation-independent mannose 6-phosphate receptor.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23277564 2013 Solubility-based genetic screen identifies RING finger protein 126 as an E3 ligase for activation-induced cytidine deaminase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23026136 2013 E3 ubiquitin ligase RNF126 promotes cancer cell proliferation by targeting the tumor suppressor p21 for ubiquitin-mediated degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
More...