Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.46
PubTator Score 4.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.3e-05
psoriasis 6694 1.4e-03
non primary Sjogren syndrome sicca 891 1.5e-02
Rheumatoid arthritis 1191 2.8e-02
Disease Target Count Z-score Confidence
Friedreich ataxia 24 3.586 1.8
Tongue cancer 2 3.258 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.5e-02
ovarian cancer 1.100 3.3e-05
psoriasis 1.200 1.4e-03
Rheumatoid arthritis -1.100 2.8e-02

Gene RIF (10)

AA Sequence

MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQSRPPLEHVDQ      1 - 70
HLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHRYGARQPRARLTTRRATGRH     71 - 140
EGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYAWGANGLDAIITQLLNQFENTGPPPADKEKI    141 - 210
QALPTVPVTEEHVGSGLECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTAT    211 - 280
NPPGLTGVSFSSSSSSSSSSSPSNENATWSPLGRPQPPRPLSNLTL                            281 - 326
//

Text Mined References (21)

PMID Year Title