Property Summary

NCBI Gene PubMed Count 19
Grant Count 123
R01 Count 38
Funding $21,541,301.22
PubMed Score 96.62
PubTator Score 101.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.244 0.002
osteosarcoma -1.803 0.000
group 4 medulloblastoma -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -2.746 0.001
subependymal giant cell astrocytoma 1.442 0.016
gastric carcinoma -1.300 0.020
ovarian cancer 1.600 0.010
pancreatic cancer 1.300 0.001

Synonym

Accession Q9BV57 D6W4Y3 Q53HW3 Q53QD3 Q57YV7 Q68CK2 Q6ZSF7 Q7Z512 Q96P85 Q9NV57
Symbols ARD
APL1
SIPL
mtnD
Fe-ARD
MTCBP1
Ni-ARD
HMFT1638

Gene

PANTHER Protein Class (1)

PDB

4QGN  

Gene RIF (6)

PMID Text
25640948 Data elucidate a new role for MTCBP-1 regulating the intracellular function of MT1-MMP-mediated autophagy. Their inverse expression correlation with brain tumor grades could also contribute to the decreased autophagic index observed in high-grade tumors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626614 293-ADI1-CD81 cells are permissive for serum-derived HCV infection.
17786183 ADI1 may check prostate cancer progression through apoptosis by an activity that does not require metal binding.
17212658 nucleo-cytoplasmic transport of hADI1 is regulated by a non-canonical nuclear export signal (NES) located in the N-terminal region of hADI1.
14718544 MTCBP-1 is a new member of the Cupin superfamily with a role as an invasion suppressor down-regulated in tumors

AA Sequence

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC      1 - 70
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK     71 - 140
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA                                   141 - 179
//

Text Mined References (22)

PMID Year Title
25640948 2016 Evidence of MTCBP-1 interaction with the cytoplasmic domain of MT1-MMP: Implications in the autophagy cell index of high-grade glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19626614 2009 293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17786183 2007 Expression and function of the human androgen-responsive gene ADI1 in prostate cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17212658 2007 Regulated nucleo-cytoplasmic shuttling of human aci-reductone dioxygenase (hADI1) and its potential role in mRNA processing.
More...