Property Summary

NCBI Gene PubMed Count 19
PubMed Score 96.62
PubTator Score 101.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
osteosarcoma 7933 5.36360732857371E-6
group 4 medulloblastoma 1875 4.07534291850308E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 9.04697861242941E-4
pancreatic cancer 2300 0.00132211933794735
Multiple myeloma 1328 0.00170658205880966
ovarian cancer 8492 0.00955912382723057
subependymal giant cell astrocytoma 2287 0.0162660244316626
gastric carcinoma 832 0.0195580673113731

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.244 0.002
osteosarcoma -1.803 0.000
group 4 medulloblastoma -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -2.746 0.001
subependymal giant cell astrocytoma 1.442 0.016
gastric carcinoma -1.300 0.020
ovarian cancer 1.600 0.010
pancreatic cancer 1.300 0.001

Synonym

Accession Q9BV57 D6W4Y3 Q53HW3 Q53QD3 Q57YV7 Q68CK2 Q6ZSF7 Q7Z512 Q96P85 Q9NV57
Symbols ARD
APL1
SIPL
mtnD
Fe-ARD
MTCBP1
Ni-ARD
HMFT1638

Gene

PANTHER Protein Class (1)

PDB

4QGN  

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
25640948 Data elucidate a new role for MTCBP-1 regulating the intracellular function of MT1-MMP-mediated autophagy. Their inverse expression correlation with brain tumor grades could also contribute to the decreased autophagic index observed in high-grade tumors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626614 293-ADI1-CD81 cells are permissive for serum-derived HCV infection.
17786183 ADI1 may check prostate cancer progression through apoptosis by an activity that does not require metal binding.
17212658 nucleo-cytoplasmic transport of hADI1 is regulated by a non-canonical nuclear export signal (NES) located in the N-terminal region of hADI1.
14718544 MTCBP-1 is a new member of the Cupin superfamily with a role as an invasion suppressor down-regulated in tumors

AA Sequence

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC      1 - 70
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK     71 - 140
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA                                   141 - 179
//

Text Mined References (22)

PMID Year Title
25640948 2016 Evidence of MTCBP-1 interaction with the cytoplasmic domain of MT1-MMP: Implications in the autophagy cell index of high-grade glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19626614 2009 293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17786183 2007 Expression and function of the human androgen-responsive gene ADI1 in prostate cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17212658 2007 Regulated nucleo-cytoplasmic shuttling of human aci-reductone dioxygenase (hADI1) and its potential role in mRNA processing.
More...