Property Summary

NCBI Gene PubMed Count 19
Grant Count 123
R01 Count 38
Funding $22,012,564.52
PubMed Score 96.62
PubTator Score 101.50

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.244 0.002
osteosarcoma -1.803 0.000
group 4 medulloblastoma -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -2.746 0.001
subependymal giant cell astrocytoma 1.442 0.016
gastric carcinoma -1.300 0.020
ovarian cancer 1.600 0.010
pancreatic cancer 1.300 0.001


Accession Q9BV57 D6W4Y3 Q53HW3 Q53QD3 Q57YV7 Q68CK2 Q6ZSF7 Q7Z512 Q96P85 Q9NV57
Symbols ARD


PANTHER Protein Class (1)



Gene RIF (6)

25640948 Data elucidate a new role for MTCBP-1 regulating the intracellular function of MT1-MMP-mediated autophagy. Their inverse expression correlation with brain tumor grades could also contribute to the decreased autophagic index observed in high-grade tumors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626614 293-ADI1-CD81 cells are permissive for serum-derived HCV infection.
17786183 ADI1 may check prostate cancer progression through apoptosis by an activity that does not require metal binding.
17212658 nucleo-cytoplasmic transport of hADI1 is regulated by a non-canonical nuclear export signal (NES) located in the N-terminal region of hADI1.
14718544 MTCBP-1 is a new member of the Cupin superfamily with a role as an invasion suppressor down-regulated in tumors

AA Sequence

NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA                                   141 - 179

Publication (22)

PMID Year Title
25640948 2016 Evidence of MTCBP-1 interaction with the cytoplasmic domain of MT1-MMP: Implications in the autophagy cell index of high-grade glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19626614 2009 293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17786183 2007 Expression and function of the human androgen-responsive gene ADI1 in prostate cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17212658 2007 Regulated nucleo-cytoplasmic shuttling of human aci-reductone dioxygenase (hADI1) and its potential role in mRNA processing.