Property Summary

NCBI Gene PubMed Count 21
PubMed Score 103.28
PubTator Score 101.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric carcinoma -1.300 2.0e-02
group 4 medulloblastoma -1.700 4.1e-05
Multiple myeloma 1.244 1.7e-03
osteosarcoma -1.803 5.4e-06
ovarian cancer -1.500 1.4e-04
pancreatic cancer 1.300 1.3e-03
pancreatic ductal adenocarcinoma liver m... -2.746 9.0e-04
subependymal giant cell astrocytoma 1.442 1.6e-02

Gene RIF (8)

AA Sequence

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC      1 - 70
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK     71 - 140
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA                                   141 - 179
//

Text Mined References (24)

PMID Year Title