Property Summary

NCBI Gene PubMed Count 19
Grant Count 34
R01 Count 15
Funding $3,973,616.17
PubMed Score 637.07
PubTator Score 66.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 0.013
posterior fossa group A ependymoma -2.800 0.000
glioblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
adrenocortical carcinoma -1.032 0.000
pediatric high grade glioma -2.000 0.000
lung adenocarcinoma -2.100 0.000
lung carcinoma 2.500 0.000

Gene RIF (7)

PMID Text
24548998 results suggest that AK2 is an associated activator of DUSP26 and suppresses cell proliferation by FADD dephosphorylation, postulating AK2 as a negative regulator of tumour growth.
23298255 The study reports the 1.68 A crystal structure of a catalytically inactive mutant (Cys152Ser) of DUSP26 lacking the first 60 N-terminal residues (DeltaN60-C/S-DUSP26).
20877624 Observational study of gene-disease association. (HuGE Navigator)
20562916 DUSP26 functions as a p53 phosphatase
20347885 DUSP26 may function as a tumour suppressor in particular cancers.
19043453 Downregulation of Dusp26 may contribute to malignant phenotypes of glioma.
16924234 DUSP26 effectively dephosphorylates p38 and has a little effect on extracellular signal-regulated kinase in anaplastic thyroid cancer.

AA Sequence

MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLY      1 - 70
LGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRA     71 - 140
LSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLE    141 - 210
A//

Publication (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24548998 2014 The DUSP26 phosphatase activator adenylate kinase 2 regulates FADD phosphorylation and cell growth.
24155099 2014 Targeting DUSPs in glioblastomas - wielding a double-edged sword?
23695260 2013 High-resolution crystal structure of the catalytic domain of human dual-specificity phosphatase 26.
23298255 2013 Atomic structure of dual-specificity phosphatase 26, a novel p53 phosphatase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20562916 2010 Dual-specificity phosphatase 26 is a novel p53 phosphatase and inhibits p53 tumor suppressor functions in human neuroblastoma.
20347885 2010 DUSP26 negatively affects the proliferation of epithelial cells, an effect not mediated by dephosphorylation of MAPKs.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19043453 2009 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
More...