Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 1.7074896038332E-8
atypical teratoid/rhabdoid tumor 1095 2.85143477760543E-7
pediatric high grade glioma 2712 3.34466392566773E-7
ovarian cancer 8492 2.09235110869041E-5
osteosarcoma 7933 9.72495248906819E-5
group 3 medulloblastoma 2254 1.91494146246808E-4
Rheumatoid Arthritis 1171 4.20632185510385E-4

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.000
osteosarcoma 1.744 0.000
glioblastoma 1.100 0.000
pediatric high grade glioma 1.100 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9BV44 Q9H8V6 Q9NVC1 Q9UFS3
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

AA Sequence

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR      1 - 70
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK     71 - 140
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD    141 - 210
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI    211 - 280
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD    281 - 350
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW    351 - 420
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV    421 - 490
HPSEQDGERGTLWQCKE                                                         491 - 507
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.