Property Summary

NCBI Gene PubMed Count 54
Grant Count 78
R01 Count 39
Funding $11,254,741.33
PubMed Score 59.26
PubTator Score 104.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.903 0.005
Multiple myeloma 1.539 0.004
malignant mesothelioma -1.100 0.000
astrocytoma 1.100 0.000
glioblastoma 3.100 0.001
osteosarcoma -2.492 0.000
posterior fossa group A ependymoma 1.400 0.000
medulloblastoma, large-cell -1.600 0.001
Duchenne muscular dystrophy 1.063 0.000
juvenile dermatomyositis 1.339 0.000
adrenocortical carcinoma -1.425 0.009
tuberculosis 1.300 0.000
lung cancer -1.600 0.000
pediatric high grade glioma 1.200 0.017
pilocytic astrocytoma 1.500 0.000
invasive ductal carcinoma 1.417 0.012
lung carcinoma -2.000 0.000
ductal carcinoma in situ 1.400 0.001
ovarian cancer 3.000 0.000
pituitary cancer -1.700 0.000

Synonym

Accession Q9BV40 O60625 Q53SP9 Q6IB09 VAMP-8
Symbols EDB
VAMP-8

Gene

PDB

4WY4  

 GWAS Trait (1)

Protein-protein Interaction (14)

Gene RIF (30)

PMID Text
26191281 our study suggested that VAMP8 gene variants might not contribute to glioma susceptibility and associated with glioma in the Chinese Han population.
26124288 Cytotoxic granule exocytosis is a sequential, multivesicle fusion process requiring VAMP8-mediated recycling endosome fusion before cytotoxic granule fusion.
25648148 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
25209430 Vesicle-associated membrane protein 8 as a novel oncogene by promoting cell proliferation and therapeutic resistance in glioma. Targeting VAMP8 may serve as a potential therapeutic regimen for the treatment of glioma.
24550300 Inhibition of VAMP8, but not VAMP7, significantly reduces viral entry.
22192511 Assessment of KIF6 genotype is not useful in predicting low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
22144578 VAMP8 regulates mucin granule exocytosis in airway goblet cells, and reduction of its expression may provide a novel therapeutic target to ameliorate airway mucus obstruction in lung diseases
21486954 Dynamics of FIP3- and VAMP8-containing endosomes reflect the progressive stages of abscission.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW      1 - 70
WKNVKMIVLICVIVFIIILFIVLFATGAFS                                             71 - 100
//

Publication (58)

PMID Year Title
26191281 2015 No association of VAMP8 gene polymorphisms with glioma in a Chinese Han population.
26124288 2015 VAMP8-dependent fusion of recycling endosomes with the plasma membrane facilitates T lymphocyte cytotoxicity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25648148 2015 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
25209430 2015 VAMP8 facilitates cellular proliferation and temozolomide resistance in human glioma cells.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23217709 2012 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...