Property Summary

NCBI Gene PubMed Count 7
PubMed Score 43.18
PubTator Score 18.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 6.95000581738107E-5
adrenocortical carcinoma 1427 0.046768212975796
Disease Target Count Z-score Confidence
Lymphoma 57 3.766 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 0.000
adrenocortical carcinoma 1.013 0.047

Synonym

Accession Q9BV38 O60390 Q9BWR2
Symbols Ipi3
R32184_1

Gene

  Ortholog (9)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
21326211 These data define the PELP1-TEX10-WDR18 complex as a regulator of ribosome biogenesis and suggests that its SUMO-controlled distribution coordinates the rate of ribosome formation.

AA Sequence

MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAWELQRK      1 - 70
DQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGG     71 - 140
KDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHCGFGGPLARVATSSLDQTVKLWEVSSGELLL    141 - 210
SVLFDVSIMAVTMDLAEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTD    211 - 280
GSVLLSGSHDETVRLWDVQSKQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGD    281 - 350
EPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF    351 - 420
DFSTRFITRPAK                                                              421 - 432
//

Text Mined References (9)

PMID Year Title
22872859 2012 Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation.
22190735 2012 LAS1L interacts with the mammalian Rix1 complex to regulate ribosome biogenesis.
21326211 2011 The SUMO system controls nucleolar partitioning of a novel mammalian ribosome biogenesis complex.
21269460 2011 Initial characterization of the human central proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.