Property Summary

NCBI Gene PubMed Count 7
PubMed Score 42.95
PubTator Score 18.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.0e-05
adrenocortical carcinoma 1428 4.7e-02
Disease Target Count Z-score Confidence
Lymphoma 81 3.68 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma 1.013 4.7e-02
psoriasis 2.100 7.0e-05

Synonym

Accession Q9BV38 O60390 Q9BWR2
Symbols Ipi3
R32184_1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (1)

AA Sequence

MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAWELQRK      1 - 70
DQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGG     71 - 140
KDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHCGFGGPLARVATSSLDQTVKLWEVSSGELLL    141 - 210
SVLFDVSIMAVTMDLAEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTD    211 - 280
GSVLLSGSHDETVRLWDVQSKQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGD    281 - 350
EPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF    351 - 420
DFSTRFITRPAK                                                              421 - 432
//

Text Mined References (9)

PMID Year Title