Property Summary

NCBI Gene PubMed Count 7
Grant Count 16
R01 Count 10
Funding $867,492.58
PubMed Score 43.18
PubTator Score 18.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 0.000
adrenocortical carcinoma 1.013 0.047

Gene RIF (1)

PMID Text
21326211 These data define the PELP1-TEX10-WDR18 complex as a regulator of ribosome biogenesis and suggests that its SUMO-controlled distribution coordinates the rate of ribosome formation.

AA Sequence

MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKNYISAWELQRK      1 - 70
DQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRHYQDVSCLQFTGDSSHFISGG     71 - 140
KDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHCGFGGPLARVATSSLDQTVKLWEVSSGELLL    141 - 210
SVLFDVSIMAVTMDLAEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTD    211 - 280
GSVLLSGSHDETVRLWDVQSKQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGD    281 - 350
EPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF    351 - 420
DFSTRFITRPAK                                                              421 - 432
//

Text Mined References (9)

PMID Year Title
22872859 2012 Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation.
22190735 2012 LAS1L interacts with the mammalian Rix1 complex to regulate ribosome biogenesis.
21326211 2011 The SUMO system controls nucleolar partitioning of a novel mammalian ribosome biogenesis complex.
21269460 2011 Initial characterization of the human central proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.