Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.27
PubTator Score 5.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-04
atypical teratoid / rhabdoid tumor -1.100 3.4e-04
ependymoma -1.600 7.0e-08
glioblastoma -1.200 2.7e-05
group 3 medulloblastoma -2.400 7.0e-05
medulloblastoma, large-cell -2.400 1.1e-06
non primary Sjogren syndrome sicca 1.100 4.2e-02
osteosarcoma -1.582 1.3e-02
primitive neuroectodermal tumor -1.400 5.3e-03
spina bifida -1.739 3.5e-02
ulcerative colitis -1.200 2.3e-08

Gene RIF (7)

AA Sequence

MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEE      1 - 70
FSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRD     71 - 140
HFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLK    141 - 210
VFMQVHASKTNRLNILGGLRSMVLEGGIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQ    211 - 280
ERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAG    281 - 350
IDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG    351 - 420
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR                          421 - 468
//

Text Mined References (13)

PMID Year Title