Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.010
ependymoma -1.200 0.029
medulloblastoma, large-cell -1.900 0.000
adrenocortical carcinoma 1.018 0.006
ovarian cancer -1.300 0.000

Synonym

Accession Q9BV29 A8KAL4 Q86TC4 Q8N788 Q8NAR7
Symbols CCDC32

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20016921 Using acetylated HIV-1 IN as bait in yeast two-hybrid screening identifies CCDC32 as IN-binding partner

AA Sequence

MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAP      1 - 70
LQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFK     71 - 140
RWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ                             141 - 185
//

Text Mined References (8)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.