Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.6e-07
medulloblastoma, large-cell 6241 1.0e-06
adrenocortical carcinoma 1428 6.1e-03
astrocytic glioma 2597 9.6e-03
ependymoma 4679 2.9e-02
Disease Target Count Z-score Confidence
Gastric cardia adenocarcinoma 3 4.647 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.018 6.1e-03
astrocytic glioma -1.300 9.6e-03
ependymoma -1.200 2.9e-02
medulloblastoma, large-cell -1.900 1.0e-06
ovarian cancer -1.300 7.6e-07

Synonym

Accession Q9BV29 A8KAL4 Q86TC4 Q8N788 Q8NAR7
Symbols C15orf57

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAP      1 - 70
LQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFK     71 - 140
RWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ                             141 - 185
//

Text Mined References (8)

PMID Year Title