Property Summary

NCBI Gene PubMed Count 13
PubMed Score 26.28
PubTator Score 15.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
non-small cell lung cancer 2798 5.10224123676392E-16
lung adenocarcinoma 2714 1.43912010325331E-11
ovarian cancer 8492 4.06297812143524E-8
nasopharyngeal carcinoma 1056 1.31754880984637E-7
malignant mesothelioma 3163 5.19648951623968E-7
atypical teratoid/rhabdoid tumor 1095 9.02091761805239E-6
tuberculosis and treatment for 6 months 686 1.53641625886792E-5
primitive neuroectodermal tumor 3031 2.26355862896233E-5
osteosarcoma 7933 4.64216469868128E-5
adult high grade glioma 2148 2.29527319554666E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.49097833932725E-4
medulloblastoma, large-cell 6234 4.17791480131341E-4
psoriasis 6685 5.02208714635079E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.15358678976505E-4
Pick disease 1893 7.89740693099657E-4
breast carcinoma 1614 0.00148162687685547
invasive ductal carcinoma 2950 0.00889502644625187
glioblastoma 5572 0.0137659998935379
subependymal giant cell astrocytoma 2287 0.0143208939971197
active ulcerative colitis 477 0.0185272994232546
Rheumatoid Arthritis 1171 0.0221625269593158

Expression

Synonym

Accession Q9BV23 B2R7Y9 Q6ZMF7
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (6)

PMID Text
26491015 data suggest that ABHD6 controls BMP catabolism and is therefore part of the late endosomal/lysosomal lipid-sorting machinery
24534757 Results confirm the genetic association of the locus 3p14.3 with systemic lupus erythematosus in Europeans and point to the ABHD6 and not PXK, as the major susceptibility gene in the region.
22969151 Data show that the three hydrolases are genuine MAG lipases; medium-chain saturated MAGs were the best substrates for hABHD6 and hMAGL, whereas hABHD12 preferred the 1 (3)- and 2-isomers of arachidonoylglycerol.
22827915 ABHD6 increases from neonatal age.
19793082 High expression of ABHD6 in Ewing family tumors (EFT) in comparison to normal tissues and other tumors suggests that ABHD6 might be an interesting new diagnostic or therapeutic target for EFT.
18360779 report the tissue distribution, subcellular location and differential distribution among cancer cell lines of Abhd6, one unannotated member of this group

AA Sequence

MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH      1 - 70
KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK     71 - 140
PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM    141 - 210
SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV    211 - 280
LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD                 281 - 337
//

Text Mined References (14)

PMID Year Title
26491015 2015 ?/? Hydrolase Domain-containing 6 (ABHD6) Degrades the Late Endosomal/Lysosomal Lipid Bis(monoacylglycero)phosphate.
24534757 2015 PXK locus in systemic lupus erythematosus: fine mapping and functional analysis reveals novel susceptibility gene ABHD6.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22969151 2012 Biochemical and pharmacological characterization of human ?/?-hydrolase domain containing 6 (ABHD6) and 12 (ABHD12).
22827915 2012 Developmental trajectory of the endocannabinoid system in human dorsolateral prefrontal cortex.
19793082 2009 High expression of the evolutionarily conserved alpha/beta hydrolase domain containing 6 (ABHD6) in Ewing tumors.
18360779 2009 An unannotated alpha/beta hydrolase superfamily member, ABHD6 differentially expressed among cancer cell lines.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...