Property Summary

NCBI Gene PubMed Count 16
PubMed Score 221.60
PubTator Score 131.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.7e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.313 2.7e-05

Gene RIF (2)

AA Sequence

MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP      1 - 70
GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDN     71 - 140
RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR    141 - 210
LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA    211 - 280
PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR    281 - 350
TALTTTISSRDGTLDGPQM                                                       351 - 369
//

Text Mined References (22)

PMID Year Title