Property Summary

NCBI Gene PubMed Count 16
PubMed Score 206.45
PubTator Score 131.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.70175019217202E-5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.313 0.000

Synonym

Accession Q9BV20 Q8NDC9 M1Pi
Symbols M1Pi
MRDI
MTNA
Ypr118w

Gene

PDB

4LDQ   4LDR  

  Ortholog (16)

Gene RIF (2)

PMID Text
23859498 Data indicate that the structural elements in MRDI distal from the MTR-1-P catalytic site are responsible for the invasion phenotype.
23124037 Identification of MRI1, encoding translation initiation factor eIF-2B subunit alpha/beta/delta-like protein, as a candidate locus for infantile epilepsy with severe cystic degeneration of the brain.

AA Sequence

MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP      1 - 70
GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDN     71 - 140
RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR    141 - 210
LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA    211 - 280
PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR    281 - 350
TALTTTISSRDGTLDGPQM                                                       351 - 369
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23859498 2013 Structure of mediator of RhoA-dependent invasion (MRDI) explains its dual function as a metabolic enzyme and a mediator of cell invasion.
23124037 2013 Identification of MRI1, encoding translation initiation factor eIF-2B subunit alpha/beta/delta-like protein, as a candidate locus for infantile epilepsy with severe cystic degeneration of the brain.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19620624 2009 A mediator of Rho-dependent invasion moonlights as a methionine salvage enzyme.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...