| Tbio | TNF receptor-associated factor 4 |
Adapter protein and signal transducer that links members of the tumor necrosis factor receptor (TNFR) family to different signaling pathways. Plays a role in the activation of NF-kappa-B and JNK, and in the regulation of cell survival and apoptosis. Regulates activation of NF-kappa-B in response to signaling through Toll-like receptors. Required for normal skeleton development, and for normal development of the respiratory tract (By similarity). Required for activation of RPS6KB1 in response to TNF signaling. Modulates TRAF6 functions.
This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Brain Injuries | 65 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| oligodendroglioma | 2850 | 1.8e-11 |
| lung adenocarcinoma | 2716 | 6.2e-10 |
| ovarian cancer | 8520 | 1.9e-09 |
| Astrocytoma, Pilocytic | 3081 | 3.3e-07 |
| atypical teratoid / rhabdoid tumor | 5112 | 1.9e-06 |
| medulloblastoma, large-cell | 6241 | 2.0e-06 |
| pediatric high grade glioma | 1064 | 8.7e-05 |
| glioblastoma | 5792 | 3.5e-04 |
| osteosarcoma | 7950 | 4.5e-04 |
| ductal carcinoma in situ | 1745 | 1.4e-03 |
| primitive neuroectodermal tumor | 3035 | 3.5e-03 |
| group 3 medulloblastoma | 4104 | 3.8e-03 |
| invasive ductal carcinoma | 2951 | 1.0e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 2.2e-02 |
| Disease | log2 FC | p |
|---|---|---|
| Astrocytoma, Pilocytic | 1.800 | 3.3e-07 |
| atypical teratoid / rhabdoid tumor | 1.300 | 1.9e-06 |
| ductal carcinoma in situ | 2.000 | 1.4e-03 |
| glioblastoma | 1.300 | 3.5e-04 |
| group 3 medulloblastoma | 1.200 | 3.8e-03 |
| intraductal papillary-mucinous neoplasm ... | 1.100 | 2.2e-02 |
| invasive ductal carcinoma | 2.000 | 1.0e-02 |
| lung adenocarcinoma | 1.300 | 6.2e-10 |
| medulloblastoma, large-cell | 1.900 | 2.0e-06 |
| oligodendroglioma | 1.200 | 1.8e-11 |
| osteosarcoma | 1.262 | 4.5e-04 |
| ovarian cancer | 1.100 | 1.9e-09 |
| pediatric high grade glioma | 1.400 | 8.7e-05 |
| primitive neuroectodermal tumor | 1.600 | 3.5e-03 |
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP 1 - 70 ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK 71 - 140 CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH 141 - 210 QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM 211 - 280 MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA 281 - 350 FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP 351 - 420 GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS 421 - 470 //
