Tbio | TNF receptor-associated factor 4 |
Adapter protein and signal transducer that links members of the tumor necrosis factor receptor (TNFR) family to different signaling pathways. Plays a role in the activation of NF-kappa-B and JNK, and in the regulation of cell survival and apoptosis. Regulates activation of NF-kappa-B in response to signaling through Toll-like receptors. Required for normal skeleton development, and for normal development of the respiratory tract (By similarity). Required for activation of RPS6KB1 in response to TNF signaling. Modulates TRAF6 functions.
This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
oligodendroglioma | 2849 | 1.77395516957785E-11 |
lung adenocarcinoma | 2714 | 6.1820853074045E-10 |
pilocytic astrocytoma | 3086 | 9.19334125662872E-9 |
group 4 medulloblastoma | 1875 | 4.80953628139456E-8 |
atypical teratoid / rhabdoid tumor | 4369 | 1.87280745763343E-6 |
medulloblastoma, large-cell | 6234 | 1.9893400604809E-6 |
ovarian cancer | 8492 | 2.7322594895253E-6 |
pediatric high grade glioma | 2712 | 8.69770671340128E-5 |
glioblastoma | 5572 | 1.39966373458009E-4 |
osteosarcoma | 7933 | 4.47966371370049E-4 |
ductal carcinoma in situ | 1745 | 0.00144881005739053 |
primitive neuroectodermal tumor | 3031 | 0.00356687887368753 |
invasive ductal carcinoma | 2950 | 0.0100963264927311 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0223714712862588 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Chromosome 17q11.2 deletion syndrome, 1.4Mb | 14 | 3.551 | 1.8 |
Mulibrey nanism | 12 | 3.293 | 1.6 |
Disease | log2 FC | p |
---|---|---|
glioblastoma | 1.700 | 0.000 |
oligodendroglioma | 1.200 | 0.000 |
osteosarcoma | 1.262 | 0.000 |
group 4 medulloblastoma | 2.000 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.300 | 0.000 |
medulloblastoma, large-cell | 1.900 | 0.000 |
primitive neuroectodermal tumor | 1.800 | 0.004 |
intraductal papillary-mucinous neoplasm ... | 1.100 | 0.022 |
pediatric high grade glioma | 1.400 | 0.000 |
pilocytic astrocytoma | 2.200 | 0.000 |
lung adenocarcinoma | 1.300 | 0.000 |
ductal carcinoma in situ | 2.000 | 0.001 |
invasive ductal carcinoma | 2.000 | 0.010 |
ovarian cancer | -1.400 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | EggNOG Inparanoid |
PMID | Text |
---|---|
26617938 | TRAF4 may promote oral squamous carcinoma cell growth, invasion and migration by Wnt/beta-catenin pathway. |
26347473 | The TRAF4-ERK5 is a dominant pathway in human skin squamous cell carcinoma. |
26331901 | There was a significant positive correlation between TRAF2 and TRAF4 expression levels in malignant pleural effusion cells |
25976502 | Data showed that TRAF4 was highly expressed in non-small cell lung cancer (NSCLC) cells, and miR-370 overexpression significantly inhibited its expression. These results suggest that TRAF4 serves as an oncogene in NSCLC. |
25973026 | these results suggest that TRAF4 promoted colon cancer cell growth and invasion |
25840457 | Recent data implicates TRAF4 in carcinogenesis. The molecular mechanism addressing TRAF4 to tight junctions involves lipid binding by the TRAF domain. Review. |
25738361 | p70s6k/S6 signaling pathway played an important role in the promoting function of TRAF4 on cell proliferation. This work suggests a new direction for understanding the oncogenic function of TRAF4 in breast cancer. |
25704480 | TRAF4 upregulated PRMT5 expression, which occurred predominantly in the nucleus, on which TRAF4 promotion of cell proliferation in breast cancer is mainly dependent. |
25700355 | promotes tumorigenesis in osteosarcoma cell lines via Akt signaling |
25591657 | Expression of tumor necrosis factor receptor-assicated factor 4 correlates with expression of Girdin and promotes nuclear translocation of Girdin in breast cancer |
More... |
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP 1 - 70 ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK 71 - 140 CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH 141 - 210 QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM 211 - 280 MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA 281 - 350 FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP 351 - 420 GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS 421 - 470 //
PMID | Year | Title |
---|---|---|
27107012 | 2016 | Pooled-matrix protein interaction screens using Barcode Fusion Genetics. |
26617938 | 2015 | TRAF4 enhances oral squamous cell carcinoma cell growth, invasion and migration by Wnt-?-catenin signaling pathway. |
26347473 | 2015 | A novel IL-17 signaling pathway controlling keratinocyte proliferation and tumorigenesis via the TRAF4-ERK5 axis. |
26331901 | 2015 | Expression, correlation, and prognostic value of TRAF2 and TRAF4 expression in malignant plural effusion cells in human breast cancer. |
25976502 | 2015 | MicroRNA-370 inhibits the progression of non-small cell lung cancer by downregulating oncogene TRAF4. |
25973026 | 2015 | TRAF4 promotes the growth and invasion of colon cancer through the Wnt/?-catenin pathway. |
25840457 | 2014 | [TRAF4, a multifaceted protein involved in carcinoma progression]. |
25738361 | 2015 | Cytoplasmic TRAF4 contributes to the activation of p70s6k signaling pathway in breast cancer. |
25704480 | 2015 | Proliferative role of TRAF4 in breast cancer by upregulating PRMT5 nuclear expression. |
25700355 | 2014 | TRAF4 enhances osteosarcoma cell proliferation and invasion by Akt signaling pathway. |
More... |