Property Summary

NCBI Gene PubMed Count 59
PubMed Score 49.80
PubTator Score 40.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.77395516957785E-11
lung adenocarcinoma 2714 6.1820853074045E-10
pilocytic astrocytoma 3086 9.19334125662872E-9
group 4 medulloblastoma 1875 4.80953628139456E-8
atypical teratoid / rhabdoid tumor 4369 1.87280745763343E-6
medulloblastoma, large-cell 6234 1.9893400604809E-6
ovarian cancer 8492 2.7322594895253E-6
pediatric high grade glioma 2712 8.69770671340128E-5
glioblastoma 5572 1.39966373458009E-4
osteosarcoma 7933 4.47966371370049E-4
ductal carcinoma in situ 1745 0.00144881005739053
primitive neuroectodermal tumor 3031 0.00356687887368753
invasive ductal carcinoma 2950 0.0100963264927311
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0223714712862588

Expression

Synonym

Accession Q9BUZ4 O75615 Q14848 Q2KJU4 Q2PJN8
Symbols CART1
MLN62
RNF83

Gene

PANTHER Protein Class (1)

PDB

2EOD   2YUC   3ZJB   4K8U   4M4E  

  Ortholog (11)

Gene RIF (40)

PMID Text
26617938 TRAF4 may promote oral squamous carcinoma cell growth, invasion and migration by Wnt/beta-catenin pathway.
26347473 The TRAF4-ERK5 is a dominant pathway in human skin squamous cell carcinoma.
26331901 There was a significant positive correlation between TRAF2 and TRAF4 expression levels in malignant pleural effusion cells
25976502 Data showed that TRAF4 was highly expressed in non-small cell lung cancer (NSCLC) cells, and miR-370 overexpression significantly inhibited its expression. These results suggest that TRAF4 serves as an oncogene in NSCLC.
25973026 these results suggest that TRAF4 promoted colon cancer cell growth and invasion
25840457 Recent data implicates TRAF4 in carcinogenesis. The molecular mechanism addressing TRAF4 to tight junctions involves lipid binding by the TRAF domain. Review.
25738361 p70s6k/S6 signaling pathway played an important role in the promoting function of TRAF4 on cell proliferation. This work suggests a new direction for understanding the oncogenic function of TRAF4 in breast cancer.
25704480 TRAF4 upregulated PRMT5 expression, which occurred predominantly in the nucleus, on which TRAF4 promotion of cell proliferation in breast cancer is mainly dependent.
25700355 promotes tumorigenesis in osteosarcoma cell lines via Akt signaling
25591657 Expression of tumor necrosis factor receptor-assicated factor 4 correlates with expression of Girdin and promotes nuclear translocation of Girdin in breast cancer
More...

AA Sequence

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP      1 - 70
ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK     71 - 140
CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH    141 - 210
QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM    211 - 280
MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA    281 - 350
FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP    351 - 420
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS                        421 - 470
//

Text Mined References (64)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26617938 2015 TRAF4 enhances oral squamous cell carcinoma cell growth, invasion and migration by Wnt-?-catenin signaling pathway.
26347473 2015 A novel IL-17 signaling pathway controlling keratinocyte proliferation and tumorigenesis via the TRAF4-ERK5 axis.
26331901 2015 Expression, correlation, and prognostic value of TRAF2 and TRAF4 expression in malignant plural effusion cells in human breast cancer.
25976502 2015 MicroRNA-370 inhibits the progression of non-small cell lung cancer by downregulating oncogene TRAF4.
25973026 2015 TRAF4 promotes the growth and invasion of colon cancer through the Wnt/?-catenin pathway.
25840457 2014 [TRAF4, a multifaceted protein involved in carcinoma progression].
25738361 2015 Cytoplasmic TRAF4 contributes to the activation of p70s6k signaling pathway in breast cancer.
25704480 2015 Proliferative role of TRAF4 in breast cancer by upregulating PRMT5 nuclear expression.
25700355 2014 TRAF4 enhances osteosarcoma cell proliferation and invasion by Akt signaling pathway.
More...