Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.001
posterior fossa group B ependymoma 1.900 0.000
non-small cell lung cancer 1.380 0.000
lung cancer 2.200 0.005
ovarian cancer 1.700 0.000

Gene RIF (1)

PMID Text
25665738 This work reported the association of 14q32.11 (EFCAB11) with Hepatocellular carcinoma in Chinese Han population and revealed the genetic interaction between STAT4 (2q32.2-q32.3) and EFCAB11 (14q32.11) in Hepatocellular carcinoma.

AA Sequence

MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPN      1 - 70
TSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVD     71 - 140
RDSDGHVSFRDFEYALNYGQKEA                                                   141 - 163
//

Text Mined References (11)

PMID Year Title
25665738 2015 Replication the association of 2q32.2-q32.3 and 14q32.11 with hepatocellular carcinoma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
21105107 2010 Genetic variations at loci involved in the immune response are risk factors for hepatocellular carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
More...