Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
non-small cell lung cancer 2890 3.7e-15
ependymoma 4679 6.5e-08
ovarian cancer 8520 2.6e-04
psoriasis 6694 1.3e-03
lung cancer 4740 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 1.1

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 6.5e-08
lung cancer 1.500 2.7e-02
non-small cell lung cancer 1.380 3.7e-15
ovarian cancer 1.700 2.6e-04
psoriasis 1.300 1.3e-03

Gene RIF (1)

AA Sequence

MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPN      1 - 70
TSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFREVD     71 - 140
RDSDGHVSFRDFEYALNYGQKEA                                                   141 - 163
//

Text Mined References (11)

PMID Year Title