Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.90
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Kaposi's sarcoma 22 3.606 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
diabetes mellitus -1.100 2.2e-03
esophageal adenocarcinoma -1.200 2.5e-02
malignant mesothelioma -2.400 1.1e-07
osteosarcoma 1.080 7.8e-03
Pick disease 1.500 7.2e-07
progressive supranuclear palsy 1.200 7.8e-03
spina bifida -3.203 3.2e-02

Gene RIF (2)

AA Sequence

MAAADLSHGHYLSGDPVCLHEEKTPAGRIVADCLTDCYQDSVTFDDVAVDFTQEEWTLLDSTQRSLYSDV      1 - 70
MLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWSILQQDFLRGQTSIGIQLEGKH     71 - 140
NGRELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTP    141 - 210
NIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVLIETLNAKKPY    211 - 280
KCKECGKGYRYPAYLSIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSG    281 - 350
LSMHVRSHSGDKPYECKECGKSFLTSSRLIQHIRTHTGEKPFVCVECGKAFAVSSNLSGHLRTHTEEKAC    351 - 420
ECKICGKVFGYPSCLNNHMRTHSAQKPYTCKECGKAFNYSTHLKIHMRIHTGEKPYECKQCGKAFSHSSS    421 - 490
FQIHERTHTGEKPYECKECGKAFTCSSSFRIHEKTHTEEKPYKCQQCGKAYSHPRSLRRHEQIH          491 - 554
//

Text Mined References (12)

PMID Year Title