Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.15
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
urothelial carcinoma -1.900 0.015
osteosarcoma 1.289 0.002
posterior fossa group B ependymoma -1.300 0.000
sonic hedgehog group medulloblastoma -1.300 0.011
astrocytoma -1.500 0.026
interstitial cystitis -1.600 0.001
ovarian cancer 1.700 0.000

Synonym

Accession Q9BUW7 Q5SYV8 Q9Y3F7
Symbols EST00098

Gene

 Compartment GO Term (0)

AA Sequence

MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEF      1 - 70
QQQLGEAPSDASP                                                              71 - 83
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...