Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.14
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Colorectal adenoma 15 3.349 1.7
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q9BUV8 E1P5U0 O00605 Q5QPG6 Q5QPG7 Q9BT03 Q9BZU7 Q9UI05
Symbols RIP5
PNAS-11

Gene

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 gp160 is identified to have a physical interaction with chromosome 20 open reading frame 24 (C20orf24) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLG      1 - 70
IAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVCVADSFTTGHLDHLLHCHPL        71 - 137
//

Text Mined References (8)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178406 2004 RIP5 is a RIP-homologous inducer of cell death.
14759258 2004 An unappreciated role for RNA surveillance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8824393 1995 The GDP/GTP cycle of Rab5 in the regulation of endocytotic membrane traffic.