Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.14
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.29834003870182E-44
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.349 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession Q9BUV8 E1P5U0 O00605 Q5QPG6 Q5QPG7 Q9BT03 Q9BZU7 Q9UI05
Symbols RIP5
PNAS-11

Gene

  Ortholog (10)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

PMID Text
22190034 HIV-1 gp160 is identified to have a physical interaction with chromosome 20 open reading frame 24 (C20orf24) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLG      1 - 70
IAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVCVADSFTTGHLDHLLHCHPL        71 - 137
//

Text Mined References (8)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178406 2004 RIP5 is a RIP-homologous inducer of cell death.
14759258 2004 An unappreciated role for RNA surveillance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8824393 1995 The GDP/GTP cycle of Rab5 in the regulation of endocytotic membrane traffic.