Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.14
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-44
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.359 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.3e-44

Gene RIF (2)

AA Sequence

MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLG      1 - 70
IAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVCVADSFTTGHLDHLLHCHPL        71 - 137
//

Text Mined References (8)

PMID Year Title