Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 0.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRSKSRSRSRRRH      1 - 70
QRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYY     71 - 140
GFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKET    141 - 210
SRGIGVSSNGAKPELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK    211 - 280
KSPYGLWIPI                                                                281 - 290
//

Text Mined References (11)

PMID Year Title