Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 0.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.75828444864963E-11
non-small cell lung cancer 2798 1.18221476773053E-10
medulloblastoma, large-cell 6234 5.02907450601935E-6
malignant mesothelioma 3163 1.23916037020827E-5
osteosarcoma 7933 2.36988082913155E-5
psoriasis 6685 5.26352312718125E-5
glioblastoma 5572 6.41298865828151E-5
lung adenocarcinoma 2714 1.22254901833489E-4
pediatric high grade glioma 2712 1.97555239919231E-4
atypical teratoid / rhabdoid tumor 4369 3.38948396797181E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00104033803811197
ependymoma 2514 0.00241291383569848
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00458196883703709
astrocytic glioma 2241 0.00472524669576721
group 4 medulloblastoma 1875 0.00625283375140388
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0121274382370634
spina bifida 1064 0.0494978040139009
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0495411949872044
Disease Target Count Z-score Confidence
Cystadenoma 7 3.492 1.7

Expression

Synonym

Accession Q9BUV0 A8K917 Q49AA4 Q5TH71 Q9GZP6
Symbols NPD014
C1orf63

Gene

  Ortholog (6)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
26209438 Results show that C1orf63 expression was elevated in tumor tissues and correlated with better prognosis for breast cancers with advanced stage but the underlying mechanism is unknown.

AA Sequence

MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRSKSRSRSRRRH      1 - 70
QRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYY     71 - 140
GFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKET    141 - 210
SRGIGVSSNGAKPELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK    211 - 280
KSPYGLWIPI                                                                281 - 290
//

Text Mined References (11)

PMID Year Title
26209438 2015 Elevated C1orf63 expression is correlated with CDK10 and predicts better outcome for advanced breast cancers: a retrospective study.
25416956 2014 A proteome-scale map of the human interactome network.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...