Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.12
PubTator Score 0.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q9BUV0 A8K917 Q49AA4 Q5TH71 Q9GZP6
Symbols NPD014
C1orf63

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRSKSRSRSRRRH      1 - 70
QRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYY     71 - 140
GFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKET    141 - 210
SRGIGVSSNGAKPELSEKVTEDGTRNPNEKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQK    211 - 280
KSPYGLWIPI                                                                281 - 290
//

Text Mined References (11)

PMID Year Title