Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.50115472952526E-6
ovarian cancer 8492 7.46200610633499E-4
Disease Target Count Z-score Confidence
Narcolepsy 69 3.865 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.542 0.000
ovarian cancer 1.100 0.001

Synonym

Accession Q9BUU2 B2RD29 D3DUF2 Q6XYB4 Q9HA03
Symbols C16orf68

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Gene RIF (1)

PMID Text
23349634 METTL22 trimethylates Lys-135 in Kin17

AA Sequence

MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHR      1 - 70
DVHTKEPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPL     71 - 140
RDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQVWRGALLLADYILFRQDLFRGCTAL    141 - 210
ELGAGTGLASIIAATMARTVYCTDVGADLLSMCQRNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVP    211 - 280
FSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSRLAHRLKNACTAILSVEKRLNFTLRHLDVTCE    281 - 350
AYDHFRSCLHALEQLADGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEPVT                    351 - 404
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140279 2014 Methylation of the DNA/RNA-binding protein Kin17 by METTL22 affects its association with chromatin.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.