Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.5e-06
ovarian cancer 8520 7.5e-04
Disease Target Count Z-score Confidence
Narcolepsy 72 3.886 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.542 6.5e-06
ovarian cancer 1.100 7.5e-04

Gene RIF (1)

AA Sequence

MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHR      1 - 70
DVHTKEPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPL     71 - 140
RDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQVWRGALLLADYILFRQDLFRGCTAL    141 - 210
ELGAGTGLASIIAATMARTVYCTDVGADLLSMCQRNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVP    211 - 280
FSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSRLAHRLKNACTAILSVEKRLNFTLRHLDVTCE    281 - 350
AYDHFRSCLHALEQLADGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEPVT                    351 - 404
//

Text Mined References (10)

PMID Year Title