Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 4.50103316531117E-17
lung adenocarcinoma 2714 3.87185637731353E-12
ulcerative colitis 2087 9.50330744624613E-7
group 4 medulloblastoma 1875 1.39261581455345E-5
ovarian cancer 8492 3.99798975961161E-5
adult high grade glioma 2148 1.06127675426487E-4
osteosarcoma 7933 7.47900933283275E-4
diabetes mellitus 1663 0.0016844772635263
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0023064681147598

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.828 0.001
pancreatic ductal adenocarcinoma liver m... -1.169 0.002
diabetes mellitus 1.800 0.002
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.200 0.000
lung adenocarcinoma 1.500 0.000
Breast cancer 1.300 0.000
ulcerative colitis -1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9BUT9 Q969E9 Q96KV8
Symbols FAM195A
C16orf14
c349E10.1

Gene

PANTHER Protein Class (3)

  Ortholog (2)

Species Source
Mouse EggNOG Inparanoid
Cow EggNOG Inparanoid

Gene RIF (1)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with family with sequence similarity 195, member A (FAM195A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSPGPRLVFNR      1 - 70
VNGRRAPSTSPSFEGTQETYTVAHEENVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFV     71 - 140
PIDLDEWWAQQFLARITSCS                                                      141 - 160
//

Text Mined References (14)

PMID Year Title
26184334 2015 Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...