Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.828 0.001
pancreatic ductal adenocarcinoma liver m... -1.169 0.002
diabetes mellitus 1.800 0.002
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.200 0.000
lung adenocarcinoma 1.500 0.000
Breast cancer 1.300 0.000
ulcerative colitis -1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9BUT9 Q969E9 Q96KV8
Symbols FAM195A
C16orf14
c349E10.1

Gene

PANTHER Protein Class (3)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with family with sequence similarity 195, member A (FAM195A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSPGPRLVFNR      1 - 70
VNGRRAPSTSPSFEGTQETYTVAHEENVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFV     71 - 140
PIDLDEWWAQQFLARITSCS                                                      141 - 160
//

Text Mined References (14)

PMID Year Title
26184334 2015 Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...