Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
Funding $59,812
PubMed Score 14.82
PubTator Score 8.01

Knowledge Summary


No data available


  Disease Relevance (1)

Disease Z-score Confidence
Gonorrhea 14 3.011 1.5



Accession Q9BUT1 A8K295 B4DUF6 Q503A0 Q6IA46 Q6UWD3 Q9H8S8 Q9NRX8
Symbols DHRS6




Gene RIF (6)

25762501 intracellular expression in macrophages is downregulated by stress and inflammation
23941109 BDH2 expression is an independent poor prognostic factor for CN-AML, with an anti-apoptotic role. Patients with high BDH2 expression have relatively shorter overall survival and a low complete response rate.
22527885 Iron-mediated post-transcriptional regulation of hBDH2 controls mitochondrial iron homeostasis in human cells.
21791085 Data show that the ketone body metabolizing enzymes BDH1, BDH2, OXCT1 and ACAT1 were expressed at the mRNA and protein level in all glioma cell lines.
20332099 Observational study of gene-disease association. (HuGE Navigator)
16380372 DHRS6 is an orphan short chain dehydrogenase/ reductase enzyme

AA Sequence

FATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL                                       211 - 245

Publication (18)

PMID Year Title
25762501 2014 Inflammation and ER stress downregulate BDH2 expression and dysregulate intracellular iron in macrophages.
23941109 2013 Human BDH2, an anti-apoptosis factor, is a novel poor prognostic factor for de novo cytogenetically normal acute myeloid leukemia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22527885 2012 Siderophore-mediated iron trafficking in humans is regulated by iron.
21791085 2011 Differential utilization of ketone bodies by neurons and glioma cell lines: a rationale for ketogenic diet as experimental glioma therapy.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.