Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.83
PubTator Score 8.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Gene RIF (7)

AA Sequence

MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFAN      1 - 70
EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSVKG     71 - 140
VVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGR    141 - 210
FATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL                                       211 - 245
//

Text Mined References (20)

PMID Year Title