Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.83
PubTator Score 8.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession Q9BUT1 A8K295 B4DUF6 Q503A0 Q6IA46 Q6UWD3 Q9H8S8 Q9NRX8
Symbols DHRS6
EFA6R
SDR15C1
UCPA-OR
UNQ6308
PRO20933

Gene

PDB

2AG5  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFAN      1 - 70
EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSVKG     71 - 140
VVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGR    141 - 210
FATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL                                       211 - 245
//

Text Mined References (20)

PMID Year Title