Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.86
PubTator Score 11.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.007
ependymoma -1.100 0.032
oligodendroglioma -1.100 0.032
psoriasis -1.100 0.002
lung cancer 3.100 0.000
lung carcinoma 1.500 0.000
Pick disease -1.200 0.000
invasive ductal carcinoma 1.200 0.000
Breast cancer 1.100 0.000

Synonym

Accession Q9BUR5 B2R4K9 Q9H3J9
Symbols MIC26
Mic23
My025
FAM121B

Gene

Gene RIF (9)

PMID Text
25764979 The human apolipoprotein MIC26 is a bona fide subunit of the MICOS complex.
24743151 APOO represents a link between impaired mitochondrial function and cardiomyopathy onset, and targeting APOO-dependent metabolic remodeling has potential as a strategy to adjust heart metabolism and protect the myocardium from impaired contractility.
24341743 It is likely that apoO participates in fatty acid metabolism and the inflammatory response in HepG2 cells.
22693255 relationships between plasma apoO levels and high-sensitive C-reactive protein (hs-CRP) levels, as well as other lipid parameters in healthy subjects and patients with established acute coronary syndrome
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
16956892 apolipoprotein O is the first chondroitin sulfate chain containing apolipoprotein

AA Sequence

MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY      1 - 70
CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP     71 - 140
GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK                141 - 198
//

Text Mined References (20)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25781180 2015 Detailed analysis of the human mitochondrial contact site complex indicate a hierarchy of subunits.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24743151 2014 Apolipoprotein O is mitochondrial and promotes lipotoxicity in heart.
24341743 2013 Microarray analysis provides new insights into the function of apolipoprotein O in HepG2 cell line.
22693255 2012 Plasma apolipoprotein O level increased in the patients with acute coronary syndrome.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21269460 2011 Initial characterization of the human central proteome.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
More...