Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.86
PubTator Score 11.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 3.1e-18
lung cancer 4740 9.3e-05
Breast cancer 3578 1.2e-04
Pick disease 1894 2.5e-04
invasive ductal carcinoma 2951 3.2e-04
psoriasis 6694 1.8e-03
astrocytic glioma 2597 6.8e-03
ependymoma 4679 3.2e-02
oligodendroglioma 2850 3.2e-02

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 6.8e-03
Breast cancer 1.100 1.2e-04
ependymoma -1.100 3.2e-02
invasive ductal carcinoma 1.200 3.2e-04
lung cancer 3.100 9.3e-05
lung carcinoma 1.500 3.1e-18
oligodendroglioma -1.100 3.2e-02
Pick disease -1.200 2.5e-04
psoriasis -1.100 1.8e-03

Gene RIF (9)

AA Sequence

MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY      1 - 70
CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP     71 - 140
GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK                141 - 198
//

Text Mined References (20)

PMID Year Title